puzzle picture
1296: Electron Density Reconstruction 1: Original Density
Status: Closed

Summary

Name: 1296: Electron Density Reconstruction 1: Original Density
Status: Closed
Created: 10/17/2016
Points: 100
Expired: 10/23/2016 - 23:00
Difficulty: Intermediate
Description: This is a followup to Puzzle 1249 and Puzzle 1274, this time with a density map drawn directly from the published structure. Players may load in solutions from Puzzle 1249 and Puzzle 1274.

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence:
SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders12,819100
2Anthropic Dreams12,79277
3Void Crushers12,78758
4L'Alliance Francophone12,77343
5Contenders12,74531

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 09/24/2012
Groups: Go Science
Bug to evolve

When loading an old shared solution, we need the oldest solution points + 2 to evolve instead of the current score + 2. This makes about 100 points to evolve.

gitwut's picture
User offline. Last seen 6 weeks 6 days ago. Offline
Joined: 05/18/2012
Groups: Contenders
Clarification

How is this different from 1249? I've reread 1249 and 1274. Isn't this the same map data used in 1249? Maybe I've forgotten, have the ED tools been re-worked since then?

Joined: 09/24/2012
Groups: Go Science
Indeed

Top score 1249 was about 13600 (but about 1000 pts less when we load it)
Top score 1274 was about 12000

If I load the best old score, I would be encouraged to work on 1249 solutions (with same cloud). What is then the expected use of 1274?

Are the score functions the same? (it seems not)

The good news is that 1274 was very slow and this problem seems solved now.

bkoep's picture
User offline. Last seen 10 hours 41 min ago. Offline
Joined: 11/15/2012
Groups: None
Model bias

In Puzzle 1249, we took some steps to reduce model bias in the density map (see this comment).

This density map should appear much cleaner and less noisy than Puzzle 1249, though it is more prone to model bias (parts of the map may be artificially reinforced to agree with the published structure).

frood66's picture
User offline. Last seen 17 hours 11 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
FWIW the density subscore

FWIW the density subscore appears lower - not looked at others

Joined: 09/24/2012
Groups: Go Science
Oh I see

Great idea to let us work on a 1274's player's design first developed in 1249 by only a few talentuous players. This helped everybody to get a "soloist" design into the cloud, which we can now further develop without a long difficult hand fold and with a published (aparently trimmed ?) cloud.

Joined: 06/06/2013
Groups: Gargleblasters
can't work in either solo or evo

I finally loaded the new client.... but this puzzle still doesn't work for me. I load an evo share and need over 1000 points to get to evo? This puzzle is broken. please zero me out. I'd really like to learn to work these. This is not the way
Suggestions in abundance on the forum thread from many players. Give us training tools please

actiasluna's picture
User offline. Last seen 3 hours 43 min ago. Offline
Joined: 03/05/2015
Groups: Gargleblasters
Need more practice on smaller ED puzzles please!

This one is a) too big for my new-to-ED eyes to see the structures, and b) can't get a good evo score due to how the evo score is being calculated, which currently is my only hope for such a large puzzle as not sufficient hours in the day between work and sleep to work this one as it needs to be worked from scratch.

Almost didn't post this as I don't want to be seen as "whining" ... I know all are in the same "scoring" boat on this, with only the best old puzzle scorers and experienced ED players having a slight edge. That written, the more we get to practice on smaller easier to see puzzles, the better our less-experienced folders will get, and quicker... which ultimately is good for the science. Thus this comment. - Thanks

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons