puzzle picture
1293b: Dysferlin C2B Domain: Predicted Contacts
Status: Closed

Summary

Name: 1293b: Dysferlin C2B Domain: Predicted Contacts
Status: Closed
Created: 10/07/2016
Points: 100
Expired: 10/14/2016 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.

This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.

Sequence:
DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD
Categories: Overall, Predicted Contacts, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams14,428100
2Beta Folders13,55274
3Gargleblasters13,17054
4Contenders13,14138
5Void Crushers13,00827

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 06/06/2013
Groups: Gargleblasters
contact map accuracy

can we assume this is mostly but not 100% correct? Thanks

bkoep's picture
User offline. Last seen 11 hours 50 min ago. Offline
Joined: 11/15/2012
Groups: None
High confidence

Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons