puzzle picture
1278: Revisiting Puzzle 69: Scorpion Toxin
Status: Closed

Summary

Name: 1278: Revisiting Puzzle 69: Scorpion Toxin
Status: Closed
Created: 08/31/2016
Points: 100
Expired: 09/07/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters10,045100
2Contenders10,02374
3Beta Folders9,99154
4Anthropic Dreams9,94538
5Go Science9,93527
Show all >

Top Evolvers

RankPlayerGroupScorePoints
1ManVsYard 57 529 Gargleblasters10,045100
2actiasluna 74 1616 Gargleblasters10,04298
3Skippysk8s 30 27 Gargleblasters10,03196
4Norrjane 74 443 Gargleblasters10,02894
5frood66 40 32 Gargleblasters10,02791
Show all >

Top Soloists

RankPlayerGroupScorePoints
1Mike Lewis 74 1616 Gargleblasters10,044100
2fiendish_ghoul 74 35  10,02798
3gitwut 74 161 Contenders10,02396
4frood66 40 32 Gargleblasters10,00994
5LociOiling 2 1 Beta Folders9,98991
Show all >


Need this puzzle? Log in to download.  

Comments

Wed, 08/31/2016 - 19:53
#1
bertro 58 401
bertro's picture
User offline. Last seen 41 weeks 4 days ago. Offline
Joined: 05/02/2011
Groups: Beta Folders
Crash with latest devprev

on win10. No debug.txt or log.txt crash info in the files. Was running a script.

Top
  • 0
Wed, 08/31/2016 - 20:03
#2
bertro 58 401
bertro's picture
User offline. Last seen 41 weeks 4 days ago. Offline
Joined: 05/02/2011
Groups: Beta Folders
again

ending of log.txt:

***** STARTING THREAD ActionGlobalMinimize
***** ENDING THREAD ActionGlobalMinimize
***** STARTING THREAD ActionIdealize
***** ENDING THREAD ActionIdealize
***** STARTING THREAD ActionGlobalMinimize
Sending SOPs:

IRC::run error, code = 5, desc = Remote connection closed
Exiting IRC::run
***** ENDING THREAD ActionGlobalMinimize
***** STARTING THREAD ActionIdealize
***** ENDING THREAD ActionIdealize
***** STARTING THREAD ActionGlobalMinimize
Sending SOPs:

Entering IRC::run
***** ENDING THREAD ActionGlobalMinimize
***** STARTING THREAD ActionIdealize
IRC::run error, code = 5, desc = Remote connection closed
Exiting IRC::run

Top
  • 0
Wed, 08/31/2016 - 20:08
#3
bertro 58 401
bertro's picture
User offline. Last seen 41 weeks 4 days ago. Offline
Joined: 05/02/2011
Groups: Beta Folders
third time

same thing, no crash info at all.

End of log.txt file:

***** STARTING THREAD ActionIdealize
***** ENDING THREAD ActionIdealize
***** STARTING THREAD ActionGlobalMinimize
IRC::run error, code = 5, desc = Remote connection closed
Exiting IRC::run
Sending SOPs:

***** ENDING THREAD ActionGlobalMinimize
***** STARTING THREAD ActionIdealize
***** ENDING THREAD ActionIdealize
***** STARTING THREAD ActionGlobalMinimize
Entering IRC::run
***** ENDING THREAD ActionGlobalMinimize
***** STARTING THREAD ActionIdealize
***** ENDING THREAD ActionIdealize
***** STARTING THREAD ActionGlobalMinimize
***** ENDING THREAD ActionGlobalMinimize

Top
  • 0
Fri, 09/02/2016 - 21:58
#4
frood66 40 32
frood66's picture
User offline. Last seen 4 weeks 10 hours ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
FWIW - this is only playable

FWIW - this is only playable for me because I'm using an old client - unplayable on current

Top
  • 0
Sat, 09/03/2016 - 17:50
#5
 bkoep 74 292
bkoep's picture
User offline. Last seen 2 hours 44 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
Main or Devprev?

We're aware of some crashing problems with the current devprev version. Did you also have problems playing this on the current version of the "main" update group?

Top
  • 0
Sat, 09/03/2016 - 20:50
#6
frood66 40 32
frood66's picture
User offline. Last seen 4 weeks 10 hours ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
apologies - yes I am on main.

apologies - yes I am on main. I would not be but for the fact there are now issues with editing options.txt. (for mac anyhow)

I can go further - current main is very slow indeed - chat is a disaster area. SO I'll stick to this old main client for now.

Top
  • 0
Sat, 09/03/2016 - 22:13
#7
actiasluna 74 1616
actiasluna's picture
User offline. Last seen 1 year 3 weeks ago. Offline
Joined: 03/05/2015
Groups: Gargleblasters
Can confirm 1278 crashes on main after latest

and submitted feedback and a crash log with info.
20160901-5afd216aff-osx_x86 is the main build I'm running.

Top
  • 0
Sat, 09/03/2016 - 23:33
#8
Skippysk8s 30 27
Skippysk8s's picture
User offline. Last seen 4 days 2 hours ago. Offline
Joined: 06/06/2013
Groups: Gargleblasters
chat crashing no matter what

I never took update and stayed on main. my IRC chat mysteriously disconnects at seeming random times (mibbit, which Bertro set up for me). My in game chat never stays connected, so I only use it to share pictures
All I can say is no one take it personally :)

Top
  • 0
Mon, 09/05/2016 - 02:52
#9
toshiue 74 952
toshiue's picture
User offline. Last seen 21 hours 43 min ago. Offline
Joined: 01/31/2016
Groups: Go Science
crashing constantly

am on main, crashing as frequently as every 10 minutes, regardless of action. completely un-playable, have not successfully completed any sequence since the crashes began. has been going on for about 16 hours now, since most recent update. am running Win 7, same end of log file as bertro posted, and am getting clusters of such in log file...

***** STARTING THREAD ActionLocalMinimize
core.optimization.LineMinimizer: Inaccurate G! step= 3.8147e-08 Deriv= -0.0834082 Finite Diff= 1.49767e+06
core.optimization.LineMinimizer: Inaccurate G! step= 9.53674e-09 Deriv= -0.0834082 Finite Diff= 5.99068e+06
core.optimization.LineMinimizer: Inaccurate G! step= 2.38419e-09 Deriv= -0.0834082 Finite Diff= 2.39627e+07
core.optimization.LineMinimizer: Inaccurate G! step= 5.96046e-10 Deriv= -0.0834082 Finite Diff= 9.58508e+07
core.optimization.LineMinimizer: Inaccurate G! step= 1.49012e-10 Deriv= -0.0834082 Finite Diff= 3.83403e+08
core.optimization.LineMinimizer: Inaccurate G! step= 3.72529e-11 Deriv= -0.0834082 Finite Diff= 1.53361e+09
core.optimization.LineMinimizer: Inaccurate G! step= 9.31323e-12 Deriv= -0.0834082 Finite Diff= 6.13445e+09
core.optimization.LineMinimizer: Inaccurate G! step= 2.32831e-12 Deriv= -0.0834082 Finite Diff= 2.45378e+10
core.optimization.LineMinimizer: Inaccurate G! step= 5.82077e-13 Deriv= -0.0834082 Finite Diff= 9.81513e+10
delta_score: -2.21917e-10
Playing sound: 4
***** ENDING THREAD ActionLocalMinimize
Tool on_action_complete called
delta_score: 0
Playing sound: 4
Tool on_action_complete called
***** STARTING THREAD ActionGlobalMinimize
core.optimization.LineMinimizer: Inaccurate G! step= 3.8147e-08 Deriv= -1.60528 Finite Diff= 1.49767e+06
core.optimization.LineMinimizer: Inaccurate G! step= 9.53674e-09 Deriv= -1.60528 Finite Diff= 5.99068e+06
core.optimization.LineMinimizer: Inaccurate G! step= 2.38419e-09 Deriv= -1.60528 Finite Diff= 2.39627e+07
core.optimization.LineMinimizer: Inaccurate G! step= 5.96046e-10 Deriv= -1.60528 Finite Diff= 9.58508e+07
core.optimization.LineMinimizer: Inaccurate G! step= 1.49012e-10 Deriv= -1.60528 Finite Diff= 3.83403e+08
core.optimization.LineMinimizer: Inaccurate G! step= 3.72529e-11 Deriv= -1.60528 Finite Diff= 1.53361e+09
core.optimization.LineMinimizer: Inaccurate G! step= 9.31323e-12 Deriv= -1.60528 Finite Diff= 6.13445e+09
core.optimization.LineMinimizer: Inaccurate G! step= 2.32831e-12 Deriv= -1.60528 Finite Diff= 2.45378e+10
core.optimization.LineMinimizer: Inaccurate G! step= 5.82077e-13 Deriv= -1.60528 Finite Diff= 9.81513e+10
core.optimization.LineMinimizer: Inaccurate G! step= 1.45519e-13 Deriv= -1.60528 Finite Diff= 3.92605e+11
core.optimization.LineMinimizer: Inaccurate G! step= 3.63798e-14 Deriv= -1.60528 Finite Diff= 1.57042e+12
Sending SOPs:

delta_score: 0
Playing sound: 4
***** ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
***** STARTING THREAD ActionLocalMinimize
core.optimization.LineMinimizer: Inaccurate G! step= 3.8147e-08 Deriv= -0.0834082 Finite Diff= 1.49767e+06
core.optimization.LineMinimizer: Inaccurate G! step= 9.53674e-09 Deriv= -0.0834082 Finite Diff= 5.99068e+06
core.optimization.LineMinimizer: Inaccurate G! step= 2.38419e-09 Deriv= -0.0834082 Finite Diff= 2.39627e+07
core.optimization.LineMinimizer: Inaccurate G! step= 5.96046e-10 Deriv= -0.0834082 Finite Diff= 9.58508e+07
core.optimization.LineMinimizer: Inaccurate G! step= 1.49012e-10 Deriv= -0.0834082 Finite Diff= 3.83403e+08
core.optimization.LineMinimizer: Inaccurate G! step= 3.72529e-11 Deriv= -0.0834082 Finite Diff= 1.53361e+09
core.optimization.LineMinimizer: Inaccurate G! step= 9.31323e-12 Deriv= -0.0834082 Finite Diff= 6.13445e+09
core.optimization.LineMinimizer: Inaccurate G! step= 2.32831e-12 Deriv= -0.0834082 Finite Diff= 2.45378e+10
core.optimization.LineMinimizer: Inaccurate G! step= 5.82077e-13 Deriv= -0.0834082 Finite Diff= 9.81513e+10
core.optimization.LineMinimizer: Inaccurate G! step= 1.45519e-13 Deriv= -0.0834082 Finite Diff= 106.25
core.optimization.LineMinimizer: Inaccurate G! step= 3.63798e-14 Deriv= -0.0834082 Finite Diff= 160.156
delta_score: 1.40062e-10
Playing sound: 4
***** ENDING THREAD ActionLocalMinimize

Top
  • 0
Mon, 09/05/2016 - 02:55
#10
toshiue 74 952
toshiue's picture
User offline. Last seen 21 hours 43 min ago. Offline
Joined: 01/31/2016
Groups: Go Science
re irc

forgot to say, rarely if ever us irc, but haven't seen any group/veteran/general irc traffic posted since the update...

Top
  • 0
Tue, 09/06/2016 - 19:29
#11
mirp 49 236
mirp's picture
User offline. Last seen 40 weeks 4 days ago. Offline
Joined: 07/24/2012
Groups: Go Science
Unplayable.

Unplayable.

Top
  • 0
Wed, 09/07/2016 - 11:57
#12
toshiue 74 952
toshiue's picture
User offline. Last seen 21 hours 43 min ago. Offline
Joined: 01/31/2016
Groups: Go Science
unplayable

ditto mirp...

Top
  • 0
Wed, 09/07/2016 - 12:26
#13
toshiue 74 952
toshiue's picture
User offline. Last seen 21 hours 43 min ago. Offline
Joined: 01/31/2016
Groups: Go Science
still crashing...

gave it one last go with 6 hours left, crashed after 32 minutes...

Top
  • 0
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons