puzzle picture
1274: Electron Density Reconstruction 1: Round 2
Status: Closed

Summary

Name: 1274: Electron Density Reconstruction 1: Round 2
Status: Closed
Created: 08/18/2016
Points: 100
Expired: 08/25/2016 - 23:00
Difficulty: Intermediate
Description: This is a followup to Puzzle 1249, with a new density map derived from a Foldit player solution. The solution seems to fit the data, but needs some refinement! Players may load in solutions from Puzzle 1249.

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence:
SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Void Crushers12,015100
2Go Science11,99974
3Contenders11,99754
4Anthropic Dreams11,99138
5Beta Folders11,98327

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

frood66's picture
User is online Online
Joined: 09/20/2011
Groups: Marvin's bunch
unable to load solutions from

unable to load solutions from 1249 - not showing in load/save window

Joined: 09/24/2012
Groups: Go Science
ok for me

You can only load solutions that you saved on local pc before. Open the 1249, take your solution and save it before to open it in the new puzzle.

frood66's picture
User is online Online
Joined: 09/20/2011
Groups: Marvin's bunch
Thx Bruno.....yep I tried all

Thx Bruno.....yep I tried all that already. Does not matter what I share in 1249 - nothing shows in 1274. I think I was devprev then - now I'm main due to the issue with options .txt keeping it's edits.

Batz's picture
User offline. Last seen 1 day 5 hours ago. Offline
Joined: 02/16/2012
Groups: Go Science
Sequence correct?

It seems that there are some mismatches with the new density here and some amino acids.
E.g. Lysine 51 looks rather than an Arginine according to the new density

actiasluna's picture
User offline. Last seen 17 hours 27 min ago. Offline
Joined: 03/05/2015
Groups: Gargleblasters
Share scoring anomaly? (and can't load old solution either)

When I loaded another player's share (from the old puzzle not a new share) it converted the score to the new puzzle but is using two points above the old (and quite a bit higher) score plus 2 points for the evo. Is this right or an anomaly?

And I could not load my old puzzle best either (after pulling in old puzzle file, was using devprev, and am not now). I will try this evening to go back to devprev and see if I can retrieve the solution (don't have time this morning).

actiasluna's picture
User offline. Last seen 17 hours 27 min ago. Offline
Joined: 03/05/2015
Groups: Gargleblasters
Retrieved the devprev

Retrieved the devprev solution and could load it,
So that worked out.

actiasluna's picture
User offline. Last seen 17 hours 27 min ago. Offline
Joined: 03/05/2015
Groups: Gargleblasters
clarifying...

The olld share converted to a score roughly 2002 points below what foldit tells me I need to evo.

bkoep's picture
User offline. Last seen 2 days 22 hours ago. Offline
Joined: 11/15/2012
Groups: None
Hmm

The magnitude of the density might have been diminished when we derived this map, so shares are probably not getting the same density bonus that they received in the previous puzzle. In future puzzles, we can take some steps to offset this kind of discrepancy.

alcor29's picture
User offline. Last seen 20 hours 3 min ago. Offline
Joined: 11/16/2012
Also see feedback
actiasluna's picture
User offline. Last seen 17 hours 27 min ago. Offline
Joined: 03/05/2015
Groups: Gargleblasters
^I exaggerated... " only"

^I exaggerated... "

only" need 1602 points LOL^

Susume's picture
User offline. Last seen 2 hours 18 min ago. Offline
Joined: 10/02/2011
Can't load as guide

I was able to load a previous puzzle solution, but I was unable to use a previous puzzle solution as a guide - error is "This guide does not match the current solution."

Susume's picture
User offline. Last seen 2 hours 18 min ago. Offline
Joined: 10/02/2011
What is the starting position?

Is the starting position the published shape that you want us to improve on?

bkoep's picture
User offline. Last seen 2 days 22 hours ago. Offline
Joined: 11/15/2012
Groups: None
Player solution

This starting position is the same Foldit solution from Puzzle 1249 that was used to derive this density map.

gitwut's picture
User offline. Last seen 6 weeks 3 days ago. Offline
Joined: 05/18/2012
Groups: Contenders
Related feedback

I have scoring discrepancies on this puzzle too:

http://fold.it/portal/node/2002692

At least the preview button is working on this node.

alwen's picture
User offline. Last seen 18 hours 42 min ago. Offline
Joined: 10/03/2011
The high score in our group

The high score in our group is 11990 (Susume's fold).

I just loaded her solo shared at 11982 points.

Evo requirement is 13619 points.

...it's possible I won't be able to evo this.

Susume's picture
User offline. Last seen 2 hours 18 min ago. Offline
Joined: 10/02/2011
My solo on 1274 came from my

My solo on 1274 came from my solo on 1249, so even though it was brought into 1274 as a solo and not as an evo, and has been saved in 1274 and loaded in a new track and saved again before sharing, it is apparently still tainted.

Joined: 09/24/2012
Groups: Go Science
evolving old design

It seems from my team that evolving design evolved from old group solution needs a lot of points to be further evolved by other team member.
Evolving a reset by any player is ok.

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons