|
1253: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed
|
Summary
| Name: | 1253: Revisiting Puzzle 59: TCR Binding Protein |
|---|---|
| Status: | Closed |
| Created: | 06/28/2016 |
| Points: | 100 |
| Expired: | 07/06/2016 - 18:00 |
| Difficulty: | Intermediate |
| Description: | This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
|
| Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
