puzzle picture
1240b: Unsolved De-novo Freestyle 80: Predicted Contacts
Status: Closed

Summary

Name: 1240b: Unsolved De-novo Freestyle 80: Predicted Contacts
Status: Closed
Created: 05/31/2016
Points: 100
Expired: 06/06/2016 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle is a repost of Puzzle 1240, which was closed early due to an error in sharing settings. In this puzzle, players should be able to correctly load in solutions from Puzzle 1237 and the original Puzzle 1240.

This is a follow-up puzzle for Puzzle 1237, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1237 and use them as a starting point here.

Sequence:
GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS
Categories: Overall, Predicted Contacts, Prediction

Top Groups

RankGroupScorePoints
1Go Science12,629100
2Anthropic Dreams12,60676
3Void Crushers12,40456
4Beta Folders12,29841
5Contenders12,09829

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

jeff101's picture
User offline. Last seen 7 hours 1 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
Library of Contact Maps:

http://foldit.wikia.com/wiki/Distance_Maps and http://memorize.com/distance-and-contact-maps show Distance and Contact Maps along-side their respective 3D images for many different proteins. Images are classified as in the SCOPe database (http://scop.berkeley.edu), and http://memorize.com/distance-and-contact-maps can shuffle the images in multiple-choice and matching modes to help you learn the patterns in them.

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons