puzzle picture
1240: Unsolved De-novo Freestyle 80: Predicted Contacts
Status: Closed

Summary

Name: 1240: Unsolved De-novo Freestyle 80: Predicted Contacts
Status: Closed
Created: 05/30/2016
Points: 0
Expired: 06/06/2016 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle was closed early due to an error in sharing settings. It has been reposted as Puzzle 1240b. Players may load solutions from this puzzle into the reposted Puzzle 1240b.

This is a follow-up puzzle for Puzzle 1237, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1237 and use them as a starting point here.

Sequence:
GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS
Categories:

Top Groups

RankGroupScorePoints
1Contenders11,6360
2Go Science11,5640
3Anthropic Dreams11,3580
4Beta Folders11,3550
5L'Alliance Francophone10,9330

Top Evolvers

RankPlayerGroupScorePoints
1mirp 13 20 Go Science11,4130

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 09/24/2012
Groups: Go Science
error

We can (not) load solutions from puzzle 1239 instead of puzzle 1237

Joined: 10/23/2014
Groups: Contenders
Unable to load correct puzzle

Same issue as Bruno Kestemont.

Joined: 04/10/2015
Groups: Beta Folders
Copy contact map info

Is it possible to have the contact map info copied as plain text / csv ?

Does anyone can post it here?

Joined: 09/24/2012
Groups: Go Science
I think you get it with this recipe:
Joined: 04/10/2015
Groups: Beta Folders
Ty for the answer

I do know that there differentes recipes that can extract that info, I was wondering if someone can run those and paste the info here because I will have a couple of hours without using foldit.
I would like to analyze the contact map anyhow...

Joined: 09/24/2012
Groups: Go Science
Here you are

"contact map"
seg1 seg2 weight ss1 ss2 distance contact banded goallen strength atom1 atom2
5 50 1 E E 151.39633717498 false true 113.54725288123 1.5 2 2
13 19 1 L H 20.187274407408 false true 15.140455805556 1.5 2 2
34 49 1 E E 50.492480420356 false true 37.869360315267 1.5 2 2
63 75 1 H E 40.374217292723 false true 30.280662969542 1.5 2 2
15 30 0.999 L L 50.492384633725 false true 37.869288475294 1.5 2 2
24 31 0.999 H E 23.615152444988 false true 17.711364333741 1.5 2 2
24 49 0.999 H E 84.120381483919 false true 63.090286112939 1.5 2 2
29 58 0.999 L H 97.57524133201 false true 73.181430999008 1.5 2 2
10 16 0.999 E H 20.18735824718 false true 15.140518685385 1.5 2 2
56 60 0.999 H H 13.457989820177 false true 10.093492365133 1.5 2 2
59 63 0.999 H H 13.457988742751 false true 10.093491557063 1.5 2 2
3 52 0.999 E E 164.85240717078 false true 123.63930537808 1.5 2 2
20 47 0.998 H E 90.847576687548 false true 68.135682515661 1.5 2 2
6 63 0.997 E H 191.76490459675 false true 143.82367844756 1.5 2 2
7 78 0.997 E L 238.86439770506 false true 179.14829827879 1.5 2 2
15 21 0.997 L H 20.186753503226 false true 15.140065127419 1.5 2 2
17 34 0.995 H E 57.215976545018 false true 42.911982408763 1.5 2 2
8 66 0.995 E H 195.13698556911 false true 146.35273917683 1.5 2 2
37 48 0.995 E E 37.048070799976 false true 27.786053099982 1.5 2 2
22 26 0.994 H H 13.457780797739 false true 10.093335598304 1.5 2 2
3 32 0.993 E E 97.574368796319 false true 73.180776597239 1.5 2 2
27 65 0.992 L H 127.84961863846 false true 95.887213978846 1.5 2 2
36 47 0.992 E E 37.047730294851 false true 27.785797721138 1.5 2 2
7 48 0.992 E E 137.94077303684 false true 103.45557977763 1.5 2 2
13 16 0.991 L H 10.247053332544 false true 7.685289999408 1.5 2 2
24 29 0.989 H L 16.913030065603 false true 12.684772549202 1.5 2 2
14 30 0.988 L L 53.832539908498 false true 40.374404931373 1.5 2 2
18 22 0.987 H H 13.458050267405 false true 10.093537700554 1.5 2 2
7 76 0.986 E E 232.13641159025 false true 174.10230869269 1.5 2 2
5 48 0.986 E E 144.6689181718 false true 108.50168862885 1.5 2 2
14 28 0.986 L L 47.103160721973 false true 35.32737054148 1.5 2 2
60 64 0.981 H H 13.458428511531 false true 10.093821383649 1.5 2 2
8 49 0.981 E E 137.94015042402 false true 103.45511281801 1.5 2 2
11 73 0.98 E E 208.59337148385 false true 156.44502861289 1.5 2 2
3 50 0.968 E E 158.12396872707 false true 118.5929765453 1.5 2 2
32 52 0.964 E E 67.290592819502 false true 50.467944614626 1.5 2 2
33 50 0.958 E E 57.216473091235 false true 42.912354818426 1.5 2 2
16 71 0.958 H L 185.03702657576 false true 138.77776993182 1.5 2 2
72 77 0.953 E E 16.913335360005 false true 12.685001520004 1.5 2 2
9 74 0.939 E E 218.67891056524 false true 164.00918292393 1.5 2 2
72 75 0.924 E E 10.246570841018 false true 7.6849281307635 1.5 2 2
51 62 0.911 E H 37.047577478156 false true 27.785683108617 1.5 2 2
19 69 0.909 H L 168.22203249872 false true 126.16652437404 1.5 2 2
56 77 0.906 H E 70.668247615177 false true 53.001185711383 1.5 2 2
23 62 0.891 H H 131.21234355426 false true 98.409257665692 1.5 2 2
24 62 0.89 H H 127.8498000194 false true 95.887350014548 1.5 2 2
17 36 0.888 H E 63.941439583419 false true 47.956079687564 1.5 2 2
20 66 0.886 H H 154.76499600039 false true 116.07374700029 1.5 2 2
10 47 0.88 E E 124.48493487969 false true 93.363701159766 1.5 2 2
69 72 0.865 L E 10.246897432882 false true 7.6851730746614 1.5 2 2
39 44 0.86 L E 16.913672368826 false true 12.68525427662 1.5 2 2
61 64 0.85 H H 10.246301869455 false true 7.6847264020913 1.5 2 2
10 72 0.841 E E 208.59348218005 false true 156.44511163504 1.5 2 2
16 72 0.828 H E 188.4077223497 false true 141.30579176227 1.5 2 2
26 65 0.819 H H 131.21263159086 false true 98.409473693149 1.5 2 2
13 71 0.813 L L 195.1368116015 false true 146.35260870113 1.5 2 2
30 52 0.809 L E 74.019094171707 false true 55.51432062878 1.5 2 2
18 31 0.798 H E 43.768860506072 false true 32.826645379554 1.5 2 2
19 71 0.795 H L 174.95100713628 false true 131.21325535221 1.5 2 2
9 46 0.792 E E 124.48501347953 false true 93.363760109651 1.5 2 2
57 61 0.781 H H 13.458647071678 false true 10.093985303759 1.5 2 2
24 51 0.778 H E 90.84702400189 false true 68.135268001418 1.5 2 2
35 48 0.778 E E 43.769290455752 false true 32.826967841814 1.5 2 2
27 61 0.776 L H 114.39198669924 false true 85.793990024433 1.5 2 2
48 57 0.774 E H 30.327281579462 false true 22.745461184597 1.5 2 2
9 76 0.735 E E 225.40783660512 false true 169.05587745384 1.5 2 2
65 68 0.733 H L 10.246090961923 false true 7.6845682214422 1.5 2 2
12 38 0.719 L E 87.476304328658 false true 65.607228246494 1.5 2 2
56 74 0.718 H E 60.561455811432 false true 45.421091858574 1.5 2 2
76 79 0.718 E L 10.245784401401 false true 7.684338301051 1.5 2 2
21 71 0.714 H L 168.22250070071 false true 126.16687552553 1.5 2 2
21 25 0.691 H H 13.458494603781 false true 10.093870952836 1.5 2 2
65 69 0.689 H L 13.457756276586 false true 10.09331720744 1.5 2 2
13 69 0.685 L L 188.40790767375 false true 141.30593075531 1.5 2 2
16 69 0.682 H L 178.30836515991 false true 133.73127386993 1.5 2 2
51 58 0.677 E H 23.615766830658 false true 17.711825122993 1.5 2 2
29 62 0.674 L H 111.02962406943 false true 83.272218052076 1.5 2 2
51 77 0.67 E E 87.477424201905 false true 65.608068151429 1.5 2 2
43 54 0.66 L L 37.046640279518 false true 27.784980209638 1.5 2 2
55 58 0.643 L H 10.246435916942 false true 7.6848269377065 1.5 2 2
17 21 0.642 H H 13.457667888605 false true 10.093250916454 1.5 2 2
63 67 0.637 H H 13.457963961907 false true 10.093472971431 1.5 2 2
23 69 0.635 H L 154.76450782075 false true 116.07338086556 1.5 2 2
39 42 0.616 L L 10.246860738782 false true 7.6851455540868 1.5 2 2
48 78 0.613 E L 100.93383669018 false true 75.700377517635 1.5 2 2
23 65 0.608 H H 141.30745333846 false true 105.98059000384 1.5 2 2
58 61 0.598 H H 10.246234283872 false true 7.6846757129042 1.5 2 2
18 25 0.592 H H 23.614950201091 false true 17.711212650818 1.5 2 2
34 58 0.592 E H 80.748900295917 false true 60.561675221938 1.5 2 2
52 61 0.58 E H 30.328131330499 false true 22.746098497874 1.5 2 2
61 65 0.555 H H 13.458141513597 false true 10.093606135198 1.5 2 2
12 16 0.549 L H 13.45754245767 false true 10.093156843253 1.5 2 2
20 69 0.534 H L 164.85182567688 false true 123.63886925766 1.5 2 2
18 21 0.534 H H 10.246083642056 false true 7.6845627315417 1.5 2 2
19 23 0.526 H H 13.458334555212 false true 10.093750916409 1.5 2 2
21 31 0.526 H E 33.645746298752 false true 25.234309724064 1.5 2 2
57 60 0.488 H H 10.246529607628 false true 7.6848972057211 1.5 2 2
4 78 0.478 E L 248.9630840928 false false 0 0
9 33 0.472 E E 80.748140021922 false true 60.561105016442 1.5 2 2
64 67 0.466 H H 10.246541562888 false true 7.6849061721663 1.5 2 2
12 18 0.459 L H 20.186615590534 false true 15.139961692901 1.5 2 2
47 53 0.45 E E 20.186899365678 false true 15.140174524258 1.5 2 2
12 47 0.443 L E 117.75649567646 false true 88.317371757345 1.5 2 2
54 62 0.432 L H 26.916541939856 false true 20.187406454892 1.5 2 2
42 45 0.43 L E 10.246049921799 false true 7.6845374413494 1.5 2 2
16 19 0.428 H H 10.246276884801 false true 7.6847076636005 1.5 2 2
12 17 0.427 L H 16.912860018341 false true 12.684645013756 1.5 2 2
27 48 0.418 L E 70.667995684044 false true 53.000996763033 1.5 2 2
10 53 0.412 E E 144.66824507818 false true 108.50118380863 1.5 2 2
33 40 0.402 E L 23.61455758637 false true 17.710918189778 1.5 2 2
17 49 0.39 H E 107.66315738915 false true 80.747368041859 1.5 2 2
23 70 0.388 H L 158.12391946192 false true 118.59293959644 1.5 2 2
6 59 0.382 E H 178.30839179915 false true 133.73129384936 1.5 2 2
39 64 0.38 L H 84.120632433429 false true 63.090474325071 1.5 2 2
60 78 0.377 H L 60.561371516834 false true 45.421028637626 1.5 2 2
39 46 0.377 L E 23.615444268529 false true 17.711583201397 1.5 2 2

Joined: 04/10/2015
Groups: Beta Folders
TY

TY

bkoep's picture
User offline. Last seen 1 hour 35 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
Sorry!

Thanks for letting us know about the sharing issue! This puzzle has been closed and reposted as Puzzle 1240b.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons