puzzle picture
1201: Revisiting Puzzle 140: Rosetta Decoy 4
Status: Closed

Summary

Name: 1201: Revisiting Puzzle 140: Rosetta Decoy 4
Status: Closed
Created: 03/01/2016
Points: 100
Expired: 03/09/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,013100
2Anthropic Dreams9,99080
3Void Crushers9,96763
4Contenders9,93349
5L'Alliance Francophone9,92837

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

spvincent's picture
User offline. Last seen 1 hour 57 min ago. Offline
Joined: 12/07/2007
Groups: Contenders
This is, I believe, the 71st

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons