puzzle picture
1188: Unsolved De-novo Freestyle 67
Status: Closed

Summary

Name: 1188: Unsolved De-novo Freestyle 67
Status: Closed
Created: 01/29/2016
Points: 100
Expired: 02/05/2016 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders9,220100
2Gargleblasters9,13980
3Beta Folders9,09463
4Go Science9,05049
5Anthropic Dreams9,02937

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 09/24/2012
Groups: Go Science
PSIPRED Prediction

I don't see it on the puzzle. Here it is:
http://bioinf.cs.ucl.ac.uk/psipred/image/?imageid=77908468

LHHHHHHHHHHHHLLLEEEEEEELLLLEEEEEEELLLLEEEELLLLHHHHHHHHHHHHHL

Joined: 10/30/2012
Groups: Beta Folders
thanks for that

thanks for that

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons