puzzle picture
1183: Unsolved De-novo Freestyle 65
Status: Closed

Summary

Name: 1183: Unsolved De-novo Freestyle 65
Status: Closed
Created: 01/15/2016
Points: 100
Expired: 01/22/2016 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
46freefolder8,2961
47Team South Africa7,2261
48DSN @ Home5,8501
49CureCoin5,6741

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 11/13/2014
Groups: None
Not sure -

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep's picture
User offline. Last seen 1 day 11 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
Hi decahedron!

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons