puzzle picture
1167: Revisiting Puzzle 114: Black Mamba
Status: Closed

Summary

Name: 1167: Revisiting Puzzle 114: Black Mamba
Status: Closed
Created: 12/09/2015
Points: 100
Expired: 12/16/2015 - 23:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,241100
2Void Crushers10,23278
3Anthropic Dreams10,20860
4Gargleblasters10,20545
5Go Science10,19733

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

jeff101's picture
User offline. Last seen 3 hours 5 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
Can you master the Five-Disulfide-Exploding-Core-Technique?

jeff101's picture
User offline. Last seen 3 hours 5 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
Or will you wind up like this guy?

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons