![]() |
1165: Unsolved De-novo Freestyle 60
Status: Closed
|
Summary
Name: | 1165: Unsolved De-novo Freestyle 60 |
---|---|
Status: | Closed |
Created: | 12/03/2015 |
Points: | 100 |
Expired: | 12/10/2015 - 23:00 |
Difficulty: | Intermediate |
Description: | The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.