|
1148: Unsolved De-novo Freestyle 58: Predicted Contacts
Status: Closed
|
Summary
| Name: | 1148: Unsolved De-novo Freestyle 58: Predicted Contacts |
|---|---|
| Status: | Closed |
| Created: | 10/12/2015 |
| Points: | 100 |
| Expired: | 10/19/2015 - 23:00 |
| Difficulty: | Intermediate |
| Description: | This is a follow-up puzzle for Puzzle 1142 and Puzzle 1145, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1142 or 1145 and use them as a starting point here.
Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR
|
| Categories: | Overall, Predicted Contacts, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Personally, I had to reset on each of the 3 versions of the puzzle (1142, 1145, 1148) because of additional information (hydrophobicity, contacts).
I wonder if it would not have been more efficient to start with the full information in only one puzzle.
Did you have interesting results for the 2 former puzzles 1142 & 1145?