puzzle picture
1148: Unsolved De-novo Freestyle 58: Predicted Contacts
Status: Closed

Summary

Name: 1148: Unsolved De-novo Freestyle 58: Predicted Contacts
Status: Closed
Created: 10/12/2015
Points: 100
Expired: 10/19/2015 - 23:00
Difficulty: Intermediate
Description: This is a follow-up puzzle for Puzzle 1142 and Puzzle 1145, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1142 or 1145 and use them as a starting point here.

Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR
Categories: Overall, Predicted Contacts, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams20,560100
2Go Science19,44284
3Another Hour Another Point19,33870
4Beta Folders19,09858
5Contenders18,70048

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 09/24/2012
Groups: Go Science
question

Personally, I had to reset on each of the 3 versions of the puzzle (1142, 1145, 1148) because of additional information (hydrophobicity, contacts).

I wonder if it would not have been more efficient to start with the full information in only one puzzle.

Did you have interesting results for the 2 former puzzles 1142 & 1145?

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons