|
1145: Unsolved De-novo Freestyle 58: Cell Membrane
Status: Closed
|
Summary
Name: |
1145: Unsolved De-novo Freestyle 58: Cell Membrane |
Status: |
Closed |
Created: |
10/05/2015 |
Points: |
100 |
Expired: |
10/12/2015 - 23:00 |
Difficulty: |
Intermediate |
Description: |
This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.
Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Comments
Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?