puzzle picture
1142: Unsolved De-novo Freestyle 58
Status: Closed

Summary

Name: 1142: Unsolved De-novo Freestyle 58
Status: Closed
Created: 09/28/2015
Points: 100
Expired: 10/05/2015 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,771100
2Go Science9,69384
3Beta Folders9,67470
4Contenders9,59357
5Hun-Magyar Csapat9,57547

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Skippysk8s's picture
User offline. Last seen 2 days 2 hours ago. Offline
Joined: 06/06/2013
Groups: Gargleblasters
bug with scoreboard

my scoreboard is totally different from what is showing up on my page and on the listings under this puzzle... others' scores also wrong
Is there a server problem with this puzzle?

Skippysk8s's picture
User offline. Last seen 2 days 2 hours ago. Offline
Joined: 06/06/2013
Groups: Gargleblasters
still think have a problem

opened a new client to save only. still not getting correct rankings or scores on this puzzzle

Batz's picture
User offline. Last seen 2 days 20 hours ago. Offline
Joined: 02/16/2012
Groups: Go Science
Different scoring function for hydrophobic regions?

Do you actually use a different score function for proteins that have a high content in hydrophobic amino acids like this protein?`

Since the sequence is predicted to have at least 4 or 5 transmembrane regions (see below, where the Ms show the membrane parts), do you distinguish between these hydrophobic parts and the soluble parts?

Or do you really want to solve the structure in solution (considering that this protein would not be stable in solution and rather form aggregates)?

##############################################################################
OCTOPUS result file
Generated from http://octopus.cbr.su.se/ at 2015-10-02 20:37:30
Total request time: 2.84 seconds.
##############################################################################

Sequence name: query_sequence
Sequence length: 176 aa.
Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFL
DKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALV
ECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

OCTOPUS predicted membrane topology:
oooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMooo
ooooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
MMMMMMMMMMMMMMMMMMMMMoMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiii

Skippysk8s's picture
User offline. Last seen 2 days 2 hours ago. Offline
Joined: 06/06/2013
Groups: Gargleblasters
programs repeatedly crashing on this puzzle

this may be too big for smaller machines....

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons