puzzle picture
1111: Unsolved De-novo Freestyle 53
Status: Closed

Summary

Name: 1111: Unsolved De-novo Freestyle 53
Status: Closed
Created: 07/07/2015
Points: 100
Expired: 07/15/2015 - 23:00
Difficulty: Intermediate
Description: This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.

Sequence:
MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,155100
2Beta Folders9,14080
3Contenders9,13363
4Void Crushers9,11249
5Go Science9,07437

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons