puzzle picture
1061: De-novo Freestyle 49: Hand-folding Round
Status: Closed

Groups

RankGroupScorePoints
26BOINC@Poland5831


Need this puzzle? Log in to download.  

Comments

bkoep's picture
User offline. Last seen 8 hours 31 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
SAM secondary structure predictions unavailable

The SAM server is out of commission for the foreseeable future, sorry!

Joined: 11/24/2014
 

It's

veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd

in case anyone wants to run their own secondary structure predictions.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons