Contest Info

Name: protein 3AB [Enterovirus C]
Owner: orangejayo1
Start Date: 03/08/15
End Date: 05/08/15
Puzzle: Freestyle Design 100
Description:

A small protein with 109 amino acids.
sequence: gplqykdlkidiktspppecindllqavdsqevrdycekkgwivnitsqvqterninramtilqavttfaavagvvyvmyklfaghqgaytglpnkkpnvptirtakvq


Registered Contestants

UserScoresort icon
orangejayo1795





Contest List
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons