Create Template Contest

Create Custom Contest

All Contests (Only Show Open Contests)

Name	Start Date	End Date	Owner	Players
(CLOSED) 565645646	06/11/10	06/12/10	yjh	0
(CLOSED) zzzzzzzzz	06/10/10	06/11/10	yjh	0
(CLOSED) Script tester 3	07/04/10	07/08/11	Krog	0
(CLOSED) 40 segment	07/16/10	07/18/10	icreatemac	0
(CLOSED) ygkas2	08/11/10	08/11/11	sotk	0
(CLOSED) Calzolai	09/01/10	11/08/10	iRob	0
(CLOSED) my contest	09/01/10	09/02/10	marissa101	0
(CLOSED) xz 07 biotechnology	09/02/10	12/31/10	xuchenidea	0
(CLOSED) Giordano's Class	09/09/10	09/13/10	cgiordano	0
(CLOSED) slither	09/16/10	12/31/13	missb	0
(CLOSED) easy!!!! :o)	10/01/10	12/31/13	yomama	0
(CLOSED) Fold It (or else)	09/20/10	09/26/10	Zeff	0
(CLOSED) Fold It (or else)	09/20/10	09/26/10	Zeff	0
(CLOSED) Alignment	10/02/10	12/31/10	sielenk	0
(CLOSED) Beta-carotene dioxygenase	10/13/10	11/05/10	mbarnkob	0
(CLOSED) prueba 1x	10/22/10	11/11/10	rascuacho	0
(CLOSED) GFP	10/18/10	10/30/10	Pyrohmstr	0
(CLOSED) SEAL MYOGLOBIN	10/23/10	10/30/10	samwitus	0
(CLOSED) Beginner Alignment puzzle	11/04/10	11/11/10	science.nerd	0
(CLOSED) PdB24	11/05/10	02/01/11	PdB24	0
(CLOSED) Free Challenge for University Students	11/18/10	12/18/10	ilya.makedon	0
(CLOSED) Daddy's	11/30/10	12/25/10	TheDaddyTired	0
(CLOSED) Grand master rival challenge	01/01/11	12/31/11	Malzarg	0
(CLOSED) Beginning Alignment Puzzle	02/04/11	02/12/11	ltchong	0
(CLOSED) The AS challenge	03/31/11	04/17/11	AgentScience	0
(CLOSED) tinglei	03/09/11	03/10/11	tinglei711	0
(CLOSED) Sheet Banding Trick	03/21/11	04/30/11	itskimo	0
(CLOSED) etrg	03/26/11	12/31/14	oxyi	0
(CLOSED) etrg	03/26/11	12/31/14	oxyi	0
(CLOSED) etrg	03/26/11	12/31/14	oxyi	0
(CLOSED) Beginners game	04/11/11	04/17/11	Zsolesz84	0
(CLOSED) khc head	04/13/11	04/20/13	ceventer	0
(CLOSED) The unbreakable Loops	05/30/11	09/22/11	lukis	0
(CLOSED) Test2	06/10/11	06/17/11	Zeljko	0
(CLOSED) m,jb ghj	06/15/11	12/31/14	oxyi	0
(CLOSED) anyone can join (actually)	07/05/11	12/16/11	madpenguin	0
(CLOSED) Atoh1 Atonal homolog 1	07/11/11	08/01/11	RANimick	0
(CLOSED) Laurabee's puzzle	07/13/11	07/14/11	laurabee	0
(CLOSED) Freestyle Competition	07/19/11	07/26/11	rattlesnake8	0
(CLOSED) Alignment test	07/23/11	07/24/11	harvardman	0
(CLOSED) Random Puzzle	08/03/11	08/04/11	Mp0907	0
(CLOSED) Freestyle Simple	08/19/11	08/21/14	WheelerLovett	0
(CLOSED) MediumFREE STYLE	08/23/11	08/31/14	WheelerLovett	0
(CLOSED) Freestyle	09/21/11	09/29/11	Stano28	0
(CLOSED) BCHS 3201	09/26/11	11/30/11	Fotis NKS	0
(CLOSED) BCHS 3201	09/26/11	11/30/11	Fotis NKS	0
(CLOSED) j	09/30/11	10/01/11	klixovann	0
(CLOSED) contest	09/27/11	12/25/11	meganium214	0
(CLOSED) contest	09/27/11	12/25/11	meganium214	0
(CLOSED) Michael and Marco	10/05/11	10/06/11	bigbanggd410	0
(CLOSED) Michael and Marco	10/05/11	10/06/11	bigbanggd410	0
(CLOSED) HIV challenge	10/09/11	10/30/11	ofc2000	0
(CLOSED) SAY HI TO ZACH	10/11/11	10/31/11	za-za22	0
(CLOSED) ACP	10/27/11	10/12/12	mike r	0
(CLOSED) just do it	10/30/11	12/31/11	pokemon.guy	0
(CLOSED) One day challenge	11/04/11	11/05/11	scienceschmoo	0
(CLOSED) JJJP bmi206 fold	11/07/11	11/30/11	Peter2000	0
(CLOSED) GTPase Ras	11/25/11	12/31/11	O Seki To	0
(CLOSED) asf	11/27/11	11/30/11	JimmyFraktal	0
(CLOSED) Myoglobin	11/30/11	12/23/11	Ronald Wichman	0
(CLOSED) jnkljnklhjnljnljnl	12/04/11	12/31/11	oxyi	0
(CLOSED) SERPINB5	12/19/11	12/26/11	Niubilism	0
(CLOSED) BLARG	12/20/11	12/21/11	Chappers	0
(CLOSED) variable freestlye design	12/21/11	12/31/11	sum	0
(CLOSED) Freestyle Design	12/24/11	12/31/11	r4m3nn00dl3s	0
(CLOSED) Can you foldit?	01/03/12	04/20/12	S-Man	0
(CLOSED) CC	01/05/12	01/07/12	obson	0
(CLOSED) test	01/12/12	01/31/12	gurimmer	0
(CLOSED) phospholipase A2 from mamushi snake venom	01/11/12	01/26/12	gurimmer	0
(CLOSED) Freedom	01/07/12	01/09/12	qbolt500	0
(CLOSED) begginer	01/10/12	01/19/12	bobbyjoejr	0
(CLOSED) Freestyle!!!	01/11/12	01/12/12	adele21	0
(CLOSED) seal myoglobin	01/13/12	01/31/12	sum	0
(CLOSED) HIV protease	01/16/12	01/17/12	recondite7	0
(CLOSED) Holotoxin	02/03/12	02/06/12	Erik.dover	0
(CLOSED) erero7 challenge	02/08/12	02/29/12	erero7	0
(CLOSED) erero7 challenge	02/08/12	02/29/12	erero7	0
(CLOSED) erero7 challenge	02/08/12	02/29/12	erero7	0
(CLOSED) cyrusi's challange	02/17/12	01/01/15	cyrusi	0
(CLOSED) Halorhodopsin	02/18/12	02/26/12	MnSOD	0
(CLOSED) Monooxygenase	03/10/12	04/30/12	hansfoldit	0
(CLOSED) dont worry	03/24/12	03/29/12	billyhuegel	0
(CLOSED) artificial muscle	03/25/12	03/31/12	AkimotoYuki	0
(CLOSED) Cameron	04/03/12	04/04/12	Cameron Baxendale	0
(CLOSED) Test	04/21/12	06/14/13	paulsen	0
(CLOSED) DcmB	04/18/12	07/13/12	shadowwalk	0
(CLOSED) Protein Contest	04/25/12	12/31/12	Dave Levine	0
(CLOSED) Let's go!!!!	04/28/12	12/12/12	wendy_rupnow	0
(CLOSED) Let's go!!!!	04/28/12	12/12/12	wendy_rupnow	0
(CLOSED) sample	05/08/12	05/22/12	govstbiochem	0
(CLOSED) Test	06/15/12	06/16/12	xDust	0
(CLOSED) coolkids2 contest	07/06/12	07/07/12	meelock	0
(CLOSED) the testing puzzle!	07/09/12	08/31/12	drumpeter18yrs9yrs	0
(CLOSED) HIV protease	07/09/12	07/31/12	drumpeter18yrs9yrs	0
(CLOSED) intracellular Caspase-Modulating Chimeric Antigen Receptor	07/17/12	07/17/14	starone	0
(CLOSED) Contest	07/30/12	07/31/12	Nicbudd77	0
(CLOSED) test asdfg	07/31/12	08/02/12	Asbiorn	0
(CLOSED) SHELL	08/09/12	08/08/13	chingsong	0
(CLOSED) test	08/09/12	08/09/13	chingsong	0
(CLOSED) Big Win	08/14/12	12/31/15	alexlan	0
(CLOSED) Beat it!	08/17/12	08/18/12	Quinton830	0
(CLOSED) d o	08/23/12	08/23/15	Joanna Staite	0
(CLOSED) Varriable Freestyle	08/30/12	09/30/12	Dishrat006	0
(CLOSED) l2pmike	09/24/12	09/25/12	OppaProteinStyleZ	0
(CLOSED) l2pmike	09/24/12	09/25/12	OppaProteinStyleZ	0
(CLOSED) Rod	10/08/12	10/09/12	Rodrigo999	0
(CLOSED) test for M-SBVfCT	10/12/12	10/13/12	tjbertram	0
(CLOSED) test of SmfT0743fCT	10/12/12	10/13/12	tjbertram	0
(CLOSED) Kenny	10/26/12	01/01/13	kennyhill	0
(CLOSED) design	11/22/12	12/31/13	smart guy	0
(CLOSED) FUN! FUN!	11/17/12	11/30/15	alexkarate	0
(CLOSED) Freestyle Design 500	11/21/12	11/22/12	Daileyc	0
(CLOSED) Black Nest of doom	11/23/12	12/31/12	mattymoe	0
(CLOSED) GTPase Ras	11/23/12	12/28/12	ridesisapis	0
(CLOSED) lms friends	12/03/12	12/04/12	johncb3	0
(CLOSED) Monkeys Rock Ham jhhh hhhhhhhhh	12/04/12	12/30/12	NathanGotSkills23	0
(CLOSED) bioinformatic task for exam	12/09/12	12/20/12	margo311	0
(CLOSED) bioinformatic task for exam	12/09/12	12/20/12	margo311	0
(CLOSED) 100 amino acids	12/09/12	12/20/12	margo311	0
(CLOSED) Easy Contest	12/12/12	12/30/12	haywick	0
(CLOSED) DR.B JWU BIOCHEM	12/19/12	02/10/13	drmbudziszek	0
(CLOSED) evaesion	12/28/12	12/31/12	Evaesion	0
(CLOSED) Testing Group Contests	01/09/13	01/10/13	auntdeen	0
(CLOSED) Mad hatter	01/17/13	01/18/13	EmperorSupreme	0
(CLOSED) LASA Octagon	02/07/13	02/10/13	JosephOleniczak	0
(CLOSED) Bio chem assignment	02/16/13	02/15/14	sonneys	0
(CLOSED) HansDampf	02/28/13	05/03/13	Wilm	0
(CLOSED) EL3 #2	03/01/13	05/03/13	Wilm	0
(CLOSED) HIV protease	03/05/13	03/26/13	alex809010	0
(CLOSED) HBV core protein	03/14/13	03/15/13	Tsogo	0
(CLOSED) A Battle in Design	03/14/13	03/14/14	TheEnderCavalier	0
(CLOSED) Contest	03/16/13	03/31/13	dallinac	0
(CLOSED) ricgtest	03/18/13	03/24/13	RicGray	0
(CLOSED) The Fountain of Youth	03/20/13	03/31/16	deinfrank	0
(CLOSED) Test 2	03/25/13	04/30/13	RicGray	0
(CLOSED) Biotech WFB HIV	03/28/13	04/09/13	KBrown	0
(CLOSED) Freestyle Design 80	04/13/13	04/20/13	JamesLeCornu	0
(CLOSED) the great vacation raceoff	06/01/13	09/30/13	shadow345	0
(CLOSED) GTPase Ras	05/15/13	05/31/13	Ninty9	0
(CLOSED) ScienceTeacherTresting	06/04/13	06/18/13	ReinhardtScience	0
(CLOSED) CASPtraining	06/10/13	06/30/13	Linux_Penguin	0
(CLOSED) Highest score	07/07/13	12/25/13	dbuske	0
(CLOSED) sup	07/09/13	07/10/13	bionano1	0
(CLOSED) De-Extinction!	07/10/13	07/31/13	gordon_wade	0
(CLOSED) UNC SHARP Contest 2	07/12/13	07/31/13	Sharp3	0
(CLOSED) Test	07/28/13	07/31/13	violinist67	0
(CLOSED) testcol4a3bp	07/18/13	12/19/13	G_H_B	0
(CLOSED) indoor soccer shoes adidas f50	07/24/13	07/26/13	Clarisonic123	0
(CLOSED) i-motif DNA structure	08/01/13	08/31/13	csjonline	0
(CLOSED) HIV Protease	09/01/13	09/28/13	Gamerrr111	0
(CLOSED) McCallie AP Biology	09/07/13	09/11/13	mccallieapbiology	0
(CLOSED) HIV	09/15/13	09/29/13	trueplayer	0
(CLOSED) battle royal	09/17/13	09/19/13	delay	0
(CLOSED) yahya	09/17/13	01/13/16	yahyamohammed	0
(CLOSED) ella introduction	09/28/13	10/28/13	manasa	0
(CLOSED) zekrom	09/30/13	01/01/14	canadajan	0
(CLOSED) dan shit	10/05/13	10/06/13	nosleevesforlife	0
(CLOSED) easy	10/09/13	10/31/16	alex90	0
(CLOSED) Come and Play	10/31/13	10/22/16	roxyroxy	0
(CLOSED) Private Contest	10/21/13	10/23/13	theOMGmonster	0
(CLOSED) progesterone reductase	10/25/13	10/25/14	sarahoconnor	0
(CLOSED) DAYDER VIRTUALIZATION	10/30/13	10/20/14	Roman Rozin	0
(CLOSED) My first contest))	11/01/13	11/07/13	krytoy1	0
(CLOSED) GTPase Ras	11/10/13	11/10/14	MyFines	0
(CLOSED) Whatever You Want	12/20/13	12/21/13	The Super Cat	0
(CLOSED) owen	01/13/14	01/20/14	owen9o930	0
(CLOSED) missing side chains	01/24/14	02/23/14	apoma	0
(CLOSED) Golden Goose	01/29/14	01/30/14	Maverik_Goose	0
(CLOSED) test arla 3	02/07/14	02/14/14	arlap	0
(CLOSED) Test	03/03/14	03/13/14	PeerPride	0
(CLOSED) Seal Myoglobin	03/03/14	03/09/14	PeerPride	0
(CLOSED) drim	03/05/14	03/06/14	emulhall	0
(CLOSED) Freestyle Symmetric Design: 40 Dimer	04/04/14	04/11/14	test_account1	0
(CLOSED) Freestyle Symmetric Design: 40 Trimer	04/04/14	04/11/14	test_account1	0
(CLOSED) Freestyle Symmetric Design: 80 Dimer	04/04/14	04/11/14	test_account1	0
(CLOSED) Freestyle Symmetric Design: 80 Trimer	04/04/14	04/11/14	test_account1	0
(CLOSED) Amazing	05/13/14	05/18/14	Botanix	0
(CLOSED) test test 12345	06/04/14	06/05/14	Seth Cooper	0
(CLOSED) frezae	07/18/14	08/31/14	frezae	0
(CLOSED) 20 amino acid-- protein	08/06/14	08/24/14	Barbaramoshi	0
(CLOSED) Immunoglobulin D Hinge H1	08/06/14	08/17/14	frogzorz	0
(CLOSED) Freestyle design 40 pc	08/17/14	09/17/14	Serraglio	0
(CLOSED) thiinngyyy cathole	08/19/14	08/31/14	aguy77	0
(CLOSED) Stefano Fuschetto	09/30/14	07/22/16	Stefano Fuschetto	0
(CLOSED) show your protein	10/10/14	10/30/14	Hydromaker107	0
(CLOSED) New_contest	11/07/14	12/09/14	pedrofong	0
(CLOSED) test test	11/08/14	11/30/14	obiwan	0
(CLOSED) test test	11/10/14	11/30/14	obiwan	0
(CLOSED) Best Design	11/09/14	11/30/14	David_M1231	0
(CLOSED) Test Post Please Ignore	11/24/14	11/25/14	rjking01	0
(CLOSED) SH3PX1	11/25/14	02/28/15	Patrick1116	0
(CLOSED) SH3PX1	11/25/14	02/28/15	Patrick1116	0
(CLOSED) SH3PX1	11/25/14	02/28/15	Patrick1116	0
(CLOSED) SH3PX1	11/25/14	02/28/15	Patrick1116	0
(CLOSED) HIV protease contest	12/04/14	12/07/14	DrewNyeTheScienceGuy	0
(CLOSED) I Dare You!!!	01/09/15	01/10/15	nakul_0702	0
(CLOSED) Come at me Bro	01/08/15	01/12/15	GentlestElm29	0
(CLOSED) Make a Greek Key	01/27/15	02/10/15	jakelmer	0
(CLOSED) Fold It League Preseason Scrimmage	02/06/15	02/14/15	DGOVIL	0
(CLOSED) Greek Key Test Run	02/11/15	03/11/15	kirkngrant	0
(CLOSED) Testacular	02/22/15	03/30/15	HerobrinesArmy	0
(CLOSED) HbA1 Test	03/11/15	03/12/15	minecraft4ever4	0
(CLOSED) G-quadruplex	03/14/15	03/02/16	kapick84	0
(CLOSED) Seymoue	03/16/15	03/19/15	ChAda2015	0
(CLOSED) D&A Mess	04/28/15	07/12/15	ChrisScientist	0
(CLOSED) Test auto	04/11/15	04/12/15	wudoo	0
(CLOSED) Helix	05/13/15	05/15/15	dendixon	0
(CLOSED) test 1111	05/15/15	12/31/15	cyj101366	0
(CLOSED) bioinf02	06/06/15	06/10/15	23RPE	0
(CLOSED) Folding con	06/16/15	06/16/16	zedOFF	0
(CLOSED) GTPase Ras Fold	06/25/15	07/01/15	BlockheadXX	0
(CLOSED) freestyle	07/11/15	09/30/15	felix1998	0
(CLOSED) Insulin	07/14/15	07/18/15	Unwise	0
(CLOSED) Peptides to design	07/26/15	01/01/16	Brabrax	0
(CLOSED) 46 Kris	07/31/15	08/07/15	kristoferkeiser	0
(CLOSED) For Science	08/07/15	09/30/15	HDRH	0
(CLOSED) Design 200	09/13/15	09/30/15	TheFlagellum	0
STD	10/01/15	12/31/18	Smellis	0
(CLOSED) GCN-4 Bipy	10/14/15	10/16/15	LiamMarshall	0
(CLOSED) AP BIO Pd. 3	10/28/15	11/03/15	smuheisen1	0
(CLOSED) outer envelope protein 80 [Arabidopsis thaliana]	11/12/15	01/05/16	swimbug2014	0
(CLOSED) Test	11/23/15	11/24/15	crostomily	0
(CLOSED) win or lose	11/28/15	12/01/15	spider876	0
(CLOSED) test	12/02/15	12/03/15	seantan	0
(CLOSED) Swaggy Folding	12/10/15	12/15/15	Atsnider	0
(CLOSED) CLASS CONTEST	02/29/16	03/31/16	Herojohn17	0
(CLOSED) Contest name	03/03/16	03/04/16	Kristian Rodman	0
(CLOSED) sgner	04/07/16	04/08/16	sgner	0
(CLOSED) Fold it!	04/19/16	06/19/16	krzysztofbulenger	0
(CLOSED) Freestyle RRM	04/22/16	11/29/16	obiwan	0
(CLOSED) Freestyle RRM	04/22/16	11/29/16	obiwan	0
(CLOSED) Zia	05/17/16	08/27/16	Ziauddin Ahmer	0
(CLOSED) Protein Stability	05/31/16	12/31/16	Alisa Southerncross	0
(CLOSED) GTPase	06/02/16	09/15/16	yjguo_10	0
(CLOSED) ARSB	06/10/16	07/29/16	szeitler18	0
(CLOSED) biyokimya_2016_1	10/19/16	10/23/16	biyokimya_2016_ismailhoca	0
(CLOSED) Raid 3	10/21/16	10/22/16	TheEnderCavalier	0
(CLOSED) Biochem 124	11/12/16	11/13/16	John Carlo dela Cruz	0
(CLOSED) Fold like the wind (blow me away)	12/11/16	12/31/16	kath2656	0
(CLOSED) SK IV	12/29/16	12/31/15	ScratchKid	0
(CLOSED) 1v Foldit-1 F2017	01/05/17	01/18/17	kipasceu	0
(CLOSED) HIV PROTEASE	01/18/17	02/01/17	gu14001	0
(CLOSED) AEL	02/14/17	02/15/17	JaeYeong	0
(CLOSED) Dave's challenge of despair	02/23/17	02/24/17	bsdn	0
(CLOSED) yuqianhengyuan	06/26/17	06/27/17	yuqianhengyuan	0
(CLOSED) Testing	08/23/17	09/21/17	Dr.Chi	0
(CLOSED) the fun alot	08/28/17	08/29/17	randcvn	0
(CLOSED) 1V1 ME UNLESS UR SCARED	10/19/17	10/21/17	I dom1nate	0
(CLOSED) bend it	10/25/17	11/05/17	Marlfox3	0
(CLOSED) Block 11	11/16/17	11/26/17	drigginar	0
(CLOSED) Cool	12/02/17	01/01/18	BaiYang	0
(CLOSED) New City Science	12/09/17	12/10/17	caitlin@newcitycharterschool.org	0
(CLOSED) ycgE	12/08/17	12/11/17	cjkunze1	0
(CLOSED) NCCS weeaboos	12/07/17	12/08/17	sushiboi	0
(CLOSED) NCCS weeaboos	12/07/17	12/08/17	sushiboi	0
(CLOSED) A Test Custom Contest	12/29/17	12/31/17	Seth Cooper	0
(CLOSED) A Test Custom Contest 2 - fold.it	12/29/17	12/31/17	Seth Cooper	0
(CLOSED) asdf	01/09/18	01/31/18	Seth Cooper	0
(CLOSED) PM_1	01/17/18	01/27/18	PM_KSienkiewicz	0
(CLOSED) Ali G	01/22/18	01/29/18	JonnyT	0
(CLOSED) pranav	01/28/18	01/29/18	pranavchels	0
(CLOSED) pranavtest	03/15/18	03/16/18	pranavchels	0
(CLOSED) 2002949_0000 test	03/22/18	03/31/18	Seth Cooper	0
(CLOSED) test17	04/03/18	04/04/18	horowsah	0
(CLOSED) test18	04/03/18	04/04/18	horowsah	0
(CLOSED) test	04/07/18	04/08/18	samicheen	0
(CLOSED) test20	04/11/18	04/12/18	horowsah	0
(CLOSED) abc	04/14/18	04/15/18	samicheen	0
(CLOSED) test description	04/16/18	04/17/18	samicheen	0
(CLOSED) test31	04/18/18	04/19/18	horowsah	0
test title	04/20/18	04/27/18	Seth Cooper	0
(CLOSED) protein to test scripts	05/22/10	12/31/10	smith92clone	1
(CLOSED) test test	05/29/10	05/30/10	CharlieFortsConscience	1
(CLOSED) Script tester - Design	01/01/30	05/24/13	Krog	1
(CLOSED) Beginner puzzle copy	05/31/10	05/18/12	Krog	1
(CLOSED) Even simpler recipe tester	05/31/10	06/30/10	Datstandin	1
(CLOSED) 20 seg script test	06/05/10	12/31/10	srssmith92	1
(CLOSED) aendgraend tested contests	06/09/10	06/13/10	aendgraend	1
(CLOSED) assasa	06/10/10	06/11/10	yjh	1
(CLOSED) The Beginner contest	06/24/10	06/30/10	Gebauer	1
(CLOSED) Test area	06/24/10	12/31/10	mat747	1
(CLOSED) Test area - HIV protease	06/24/10	12/31/10	mat747	1
(CLOSED) Freestyle 80 for a month	06/25/10	07/31/10	sehskyle	1
(CLOSED) Script tester 2	07/04/10	07/05/12	Krog	1
(CLOSED) Script tester 3	07/04/10	07/08/11	Krog	1
(CLOSED) M	07/05/10	07/31/13	RoboMonkey	1
(CLOSED) asdfadf	07/05/10	07/29/10	RoboMonkey	1
(CLOSED) a	07/11/10	07/25/10	asianboy26	1
(CLOSED) 80segment	07/12/10	07/31/10	asianboy26	1
(CLOSED) a.l	07/13/10	07/15/10	asianboy26	1
(CLOSED) hiv protease	07/11/10	07/17/10	asianboy26	1
(CLOSED) GTPase	07/11/10	08/31/10	Jordandk	1
(CLOSED) math modeling	07/16/10	07/29/12	themarquis	1
(CLOSED) Contest name goes here?	08/02/10	08/05/10	oakwhiz	1
(CLOSED) Phalpha1beta	08/14/10	08/15/10	mvackel	1
(CLOSED) CD44 protein	08/14/10	08/24/10	mikedressner	1
(CLOSED) The science is pure science	08/15/10	08/21/10	Dj-P	1
(CLOSED) GTPase Ras	08/18/10	08/31/10	cyclic3	1
(CLOSED) 1	08/19/10	08/31/10	lipasesucks	1
(CLOSED) 12	08/19/10	08/31/10	lipasesucks	1
(CLOSED) test	08/19/10	08/20/10	beta_helix	1
(CLOSED) HiV try	08/20/10	09/20/10	Pyotr	1
(CLOSED) Test	08/21/10	08/23/10	Acida-2	1
(CLOSED) Freestyle Design 80	08/21/10	10/31/10	Handful	1
(CLOSED) motor protein tail	08/23/10	08/23/11	ceventer	1
(CLOSED) ygkas 1-80	08/23/10	08/23/11	sotk	1
(CLOSED) ygkas1 40-120	08/26/10	08/26/11	sotk	1
(CLOSED) Target 611 - Test	08/29/10	08/30/10	Cyanoia	1
(CLOSED) BattleGrounds....v.5655.88	08/31/10	08/24/13	InsaneGamer1457	1
(CLOSED) Loss Cancer	08/31/10	12/31/10	FalconDeOro	1
(CLOSED) Aids Security	09/02/10	01/22/11	Gaara	1
(CLOSED) Test Range- HIV Lab	09/01/10	09/05/10	buddy1018	1
(CLOSED) bonebreake	09/09/10	09/17/10	baeda	1
(CLOSED) BP's 611	09/10/10	09/11/10	Bletchley Park	1
(CLOSED) PhAlpha1Beta	09/12/10	09/13/10	mvackel	1
(CLOSED) PhAlpha1Beta	09/12/10	09/15/10	mvackel	1
(CLOSED) Contest10000G1	09/14/10	10/01/10	crispy fry	1
(CLOSED) best score	09/17/10	09/21/10	Willbee	1
(CLOSED) test	09/19/10	09/20/10	rangerQ	1
(CLOSED) Long Contest	09/20/10	01/01/12	maquiladora	1
(CLOSED) free style 500	09/20/10	10/31/10	ethanIc	1
(CLOSED) Script Test IV	09/21/10	01/31/11	Crashguard303	1
(CLOSED) mva1alpha	09/22/10	09/21/11	mvackel	1
(CLOSED) Superkittyhorse proteins	09/27/10	12/31/10	avapenny	1
(CLOSED) Need structure	09/29/10	10/10/10	canikickit49	1
(CLOSED) Alignment	10/02/10	12/31/10	sielenk	1
(CLOSED) AATG TK Bioteknologi	10/04/10	10/08/10	thomas.holm@gmail.com	1
(CLOSED) random test	10/12/10	12/31/10	Ryanfav	1
(CLOSED) kanya	10/14/10	10/26/10	g5314401673	1
(CLOSED) khc test	10/14/10	10/14/11	ceventer	1
(CLOSED) Test	10/15/10	10/16/10	Pyrohmstr	1
(CLOSED) Test	10/15/10	10/23/10	Pyrohmstr	1
(CLOSED) Freestyle Design 80	10/17/10	10/01/11	BlueRabit	1
(CLOSED) meh	10/17/10	10/31/10	anthunk	1
(CLOSED) GFP	10/18/10	10/30/10	Pyrohmstr	1
(CLOSED) GFP1	10/18/10	10/30/10	Pyrohmstr	1
(CLOSED) P1a1b	10/22/10	10/21/11	mvackel	1
(CLOSED) niep	10/24/10	10/26/10	niep0329	1
(CLOSED) CASP9 Target 611	10/24/10	11/30/10	cd11	1
(CLOSED) test	10/25/10	10/31/13	centic	1
(CLOSED) XY	10/28/10	10/29/10	PdB24	1
(CLOSED) PdB24	11/05/10	02/01/11	PdB24	1
(CLOSED) Alabudzki	11/06/10	12/31/10	alabudzki	1
(CLOSED) MRMAND123	11/09/11	11/09/12	MR MAN D	1
(CLOSED) hard	11/13/10	12/31/10	marshin	1
(CLOSED) hiv	11/12/10	01/16/11	marshin	1
(CLOSED) hotu	11/12/10	11/30/10	marshin	1
(CLOSED) SKHJGFDRSKL	11/12/10	11/30/10	marshin	1
(CLOSED) Design a protein	11/18/10	12/18/10	svenskhan	1
(CLOSED) seal myoglobin	12/01/10	12/01/12	traywright	1
(CLOSED) Sandbox-40	12/01/10	12/02/10	kevinjh	1
(CLOSED) Unl. Sandbox	12/02/10	12/31/10	kevinjh	1
(CLOSED) BiChE Easy puzzle	12/08/10	12/10/10	ejf3c	1
(CLOSED) AIDS	12/08/10	12/31/11	colonelpaco	1
(CLOSED) Freestyle Design 500	12/09/10	12/12/10	MHannigan	1
(CLOSED) Fun	12/12/10	12/31/10	bost29	1
(CLOSED) Large Protein Test	12/14/10	12/15/10	Gray Thomas	1
(CLOSED) Pedobacter Beta Barrel	12/14/10	12/25/10	Gray Thomas	1
(CLOSED) ??	12/20/10	01/01/11	reedbc	1
(CLOSED) HIV Crash test	12/21/10	12/31/11	Dr Tyrell	1
(CLOSED) Freestyle Multi-start 499.9	12/22/10	01/01/11	Dj-P	1
(CLOSED) AT Testing	12/22/10	12/26/10	anthunk	1
(CLOSED) FreestyleBKG	12/22/10	12/31/13	aricc	1
(CLOSED) AT Testing Too	12/22/10	12/26/10	anthunk	1
(CLOSED) CHEM 1460 Puzzle	02/04/11	02/12/11	ltchong	1
(CLOSED) CHEM 1460 Puzzle 2	02/04/11	02/11/11	ltchong	1
(CLOSED) FOLD Championship	12/23/10	12/31/10	Dj-P	1
(CLOSED) GTPase Ras 1.0	12/23/10	12/31/10	Dj-P	1
(CLOSED) HIV protease	01/02/11	01/01/12	maksimlekler	1
(CLOSED) Beginner Alignment Puzzle	01/02/11	01/01/12	maksimlekler	1
(CLOSED) CASP training puzzle	01/02/11	01/01/12	maksimlekler	1
(CLOSED) CASP9 Target 611 residue protein	01/02/11	01/01/12	maksimlekler	1
(CLOSED) CASP9 target Design?	01/02/11	01/01/12	maksimlekler	1
(CLOSED) SEAL MYOGLOBIN	01/02/11	01/01/12	maksimlekler	1
(CLOSED) Contest Template Test	01/02/11	01/01/12	maksimlekler	1
(CLOSED) Blank	01/04/11	12/31/11	kevinjh	1
(CLOSED) LUA test	01/05/11	01/30/11	Dj-P	1
(CLOSED) test	01/05/11	01/06/11	omelet bob	1
(CLOSED) test	01/05/11	01/06/11	omelet bob	1
(CLOSED) Test	01/06/11	01/13/11	Roedl	1
(CLOSED) Threading	01/06/11	01/13/11	AmyLia330	1
(CLOSED) Halobacterium NRC-1 Hypothetical Protein	01/08/11	05/31/11	pramodbhat	1
(CLOSED) Pass the Thyme	01/09/11	02/28/11	TheGUmmer	1
(CLOSED) HIV protease	01/09/11	12/31/14	Alegend45	1
(CLOSED) Freestyle Design Variable Length	01/09/11	01/01/12	ten04031977	1
(CLOSED) mine silly	01/17/11	12/31/11	anthunk	1
(CLOSED) Laccase	01/19/11	01/23/11	El_Crazy_Xabi	1
(CLOSED) Black box42	02/09/11	02/11/11	DaVinci21	1
(CLOSED) binding motif test	02/16/11	02/03/12	ceventer	1
(CLOSED) Dj-P's duel puzzle	02/17/11	02/18/11	Dj-P	1
(CLOSED) god berry	02/18/11	03/12/11	My Cranky Panda	1
(CLOSED) first	02/20/11	12/31/11	jojotastic777	1
(CLOSED) Truncated human ryanodine receptor 2	02/21/11	05/31/11	Fnallerdaller	1
(CLOSED) Truncated Human Ryanodine Receptor 2 v2	02/22/11	05/29/11	Fnallerdaller	1
(CLOSED) first	02/25/11	12/31/11	alex2011	1
(CLOSED) CASP9 targed Design test, all welcome	03/01/11	07/01/11	tyler0911	1
(CLOSED) bugster	03/05/11	04/30/11	alex2011	1
(CLOSED) Pregnancy Associated Plasma Protein (PAPP-A)	03/12/11	08/15/11	meschruhms	1
(CLOSED) CRAZY	03/12/11	03/17/11	alex2011	1
(CLOSED) contest	03/19/11	05/22/11	protein123	1
(CLOSED) lv.1	03/28/11	04/03/11	Marco Chan	1
(CLOSED) kk's contest	04/20/11	04/30/11	kkwizard101	1
(CLOSED) Freestyle Design: Variable Length	04/28/11	05/31/11	Acida-2	1
(CLOSED) SEAL MYOGLOBIN	04/28/11	05/31/11	Acida-2	1
(CLOSED) more testing	05/04/11	12/31/14	anthunk	1
(CLOSED) Easy first alignment	05/09/11	05/31/11	serico7	1
(CLOSED) Ykl071w Amino acid sequence	05/09/11	05/31/11	Dendroid	1
(CLOSED) vhcvhvghgvhjhghjhgjkjyhjgjhjkhkjyh	05/18/11	05/19/11	oxyi	1
(CLOSED) dhtrjkg vbuibmjjmknv n bogf bjh mknknb	05/18/11	05/19/11	oxyi	1
(CLOSED) dhtrjkg vbuibmjjmknv n bogf bjh mknkn	05/18/11	05/19/14	oxyi	1
(CLOSED) dhtrjkg vbuibmjjmknv n bogf bjh mknkn	05/18/11	05/19/14	oxyi	1
(CLOSED) 576i	05/21/11	12/31/14	oxyi	1
(CLOSED) fbdfnbdgn	05/23/11	12/31/14	oxyi	1
test 2	05/24/11	12/31/29	gurch	1
(CLOSED) HIV protease contest!	05/29/11	05/31/11	chouti	1
(CLOSED) Test	06/04/11	06/11/11	Zeljko	1
(CLOSED) HIV attack	06/05/11	06/30/12	Overlord13	1
(CLOSED) m,jb ghj	06/15/11	12/31/14	oxyi	1
(CLOSED) hnvfcfhncfh kbkkkh	06/15/11	12/31/14	oxyi	1
(CLOSED) Freestyle Design - 20 (ST - Recipe Research Channel)	06/18/11	06/30/11	Seagat2011	1
(CLOSED) Freestyle Design Competition	06/20/11	06/30/11	Dinoclor	1
(CLOSED) any one can join too	06/26/11	09/01/11	plh	1
(CLOSED) vghubzysd rx	07/31/11	12/31/13	oxyi	1
(CLOSED) Test	07/15/11	07/01/12	berus	1
(CLOSED) Test2	07/15/11	07/17/11	berus	1
(CLOSED) Freebuild	07/18/11	07/20/11	e-wok456	1
(CLOSED) freebuild2	07/18/11	07/20/11	e-wok456	1
(CLOSED) Let's have fun.	07/25/11	08/02/11	etety33	1
(CLOSED) Mr Ma No.1	07/27/11	07/31/12	mayumiao	1
(CLOSED) To have fun	07/29/11	07/20/14	mayumiao	1
(CLOSED) Mr Ma No. One	07/29/11	07/29/14	mayumiao	1
(CLOSED) Random Puzzle	08/03/11	08/04/11	Mp0907	1
(CLOSED) 430	08/03/11	08/04/11	laurabee	1
(CLOSED) PODXL	08/04/11	08/26/11	machoo	1
(CLOSED) Freestyle Simple	08/19/11	08/21/14	WheelerLovett	1
(CLOSED) laura test	08/23/11	08/24/11	laurabee	1
(CLOSED) laura test2	08/23/11	08/24/11	laurabee	1
(CLOSED) MediumFREE STYLE	08/23/11	08/31/14	WheelerLovett	1
(CLOSED) GTPase Ras	09/10/11	09/01/12	glenwayguy	1
(CLOSED) VopX	09/20/11	10/20/11	rabidfurball	1
(CLOSED) my contest	09/20/11	12/20/11	Lysergic cure	1
(CLOSED) Dengue Virus NS3 protease domain	09/26/11	10/31/11	Neffets	1
(CLOSED) arabic group	09/22/11	09/22/14	ahmed magdy	1
(CLOSED) aj	09/23/11	09/24/11	ilikeike	1
(CLOSED) CURE CANCER win	09/24/11	09/25/12	Ross3	1
(CLOSED) Facile for Italian :)	09/24/11	10/24/11	Vaio	1
(CLOSED) Multi-histidine and Glutamate sequence complexed with Mn(II)	09/26/11	10/10/11	masspeana	1
(CLOSED) HIV protease new	09/29/11	10/31/11	davidpat	1
(CLOSED) test00	09/29/11	09/30/11	spacevet	1
(CLOSED) test071	10/07/11	10/09/11	b3au071	1
(CLOSED) efeli	10/11/11	10/12/11	chatask	1
(CLOSED) ClpB	10/09/11	10/28/12	kevinjh	1
(CLOSED) Short Blank	10/10/11	10/31/12	kevinjh	1
(CLOSED) Sandbox	10/10/11	10/31/12	kevinjh	1
(CLOSED) test	10/12/11	10/13/11	laurenting	1
(CLOSED) BMI 206 test contest - protease	10/12/11	10/13/11	amelie.stein	1
(CLOSED) BMI 206 test contest - Ras	10/12/11	10/14/11	amelie.stein	1
(CLOSED) Freestyle Design 500	10/16/11	11/06/11	ofc2000	1
(CLOSED) HIV protease	10/17/11	10/22/11	Joshua Algode	1
(CLOSED) GTPase Ras	10/19/11	03/18/12	wangyueyun	1
(CLOSED) hiv protease	10/19/11	10/19/12	jerrywhite13	1
(CLOSED) casp training	10/20/11	10/31/11	vk1982	1
(CLOSED) first contest	10/20/11	10/21/11	Robinso	1
(CLOSED) My first contest	10/26/11	10/31/11	awesome4132	1
(CLOSED) ACP	10/27/11	10/12/12	mike r	1
(CLOSED) ofc2000's tough challenge (open)	10/29/11	10/31/11	ofc2000	1
(CLOSED) One day challenge	11/04/11	11/05/11	scienceschmoo	1
(CLOSED) Dog tests himself	11/07/11	11/08/11	est000dog	1
(CLOSED) PA1955_Repeat	11/10/11	12/23/11	MadsTS	1
(CLOSED) hemoglobin check	11/26/11	11/30/11	Rellis	1
(CLOSED) Seal Myoglobin	11/26/11	11/29/11	Lelivret	1
(CLOSED) a	11/27/11	12/19/11	JimmyFraktal	1
(CLOSED) Test_steveB	12/01/11	12/08/11	steveB	1
(CLOSED) Governors Academy Freestylin'	12/02/11	12/04/11	conorodea111	1
(CLOSED) jnkljnklhjnljnljnl	12/04/11	12/31/11	oxyi	1
(CLOSED) Beginner Alignment Puzzle	12/06/11	12/31/11	kitek314_pl	1
(CLOSED) Cancer Puzzle	12/11/11	12/25/11	EzraThexton	1
(CLOSED) Test Puzzle	12/18/11	12/19/11	kurenan	1
(CLOSED) Montcrest for real	12/20/11	01/31/12	Chappers	1
(CLOSED) Montcrest	12/20/11	01/31/12	Chappers	1
(CLOSED) hjjjjjjjjjjjjjjjjjj	12/20/11	12/31/14	oxyi	1
(CLOSED) my freestyle trial	12/20/11	12/27/11	Niubilism	1
(CLOSED) Small partial Tspan peptide	12/21/11	12/31/11	rwarn	1
(CLOSED) variable freestlye design	12/21/11	12/31/11	sum	1
(CLOSED) jujujujujujujujujujujujujuj ujujujujujujujujujujujujujujujujujujujujujujuju	12/24/11	12/31/14	oxyi	1
(CLOSED) Quick & Dirty KnotFind	12/25/11	01/03/12	NessunDorma	1
(CLOSED) Test Protein	12/26/11	03/31/12	kurenan	1
(CLOSED) vroom	01/02/12	01/28/12	kasmol	1
(CLOSED) test	01/12/12	01/31/12	gurimmer	1
(CLOSED) Test test	01/06/12	01/13/12	smfuchs	1
(CLOSED) Can you win?	01/06/12	01/07/12	thekidsglenn7	1
(CLOSED) HIV	01/07/12	02/11/12	fallenspartan	1
(CLOSED) prova	01/08/12	01/17/12	hu74go	1
(CLOSED) FANTASY	01/09/12	01/10/12	hu74go	1
(CLOSED) seal myoglobin	01/13/12	01/31/12	sum	1
(CLOSED) Degradation of Wood! Lets understand methane and CO2 production!	01/21/12	09/30/12	losWEEDos	1
(CLOSED) Hexaguin's Freestyle 80	01/22/12	01/31/12	hexaguin	1
(CLOSED) myoglobin	01/22/12	01/26/12	vacmar	1
(CLOSED) HIV protease	01/25/12	01/31/12	docfon	1
(CLOSED) Bioc_670_2	01/26/12	02/10/12	bkuhlman	1
(CLOSED) Bioc_670_Protease	01/26/12	02/10/12	bkuhlman	1
(CLOSED) Just For Fun	01/26/12	01/27/12	Metadryad	1
(CLOSED) Random	01/28/12	01/31/12	dabanks	1
(CLOSED) Trying something out :) pardon	01/31/12	02/29/12	PeptideMuncher	1
(CLOSED) Theoredoxin	01/31/12	01/31/14	PeptideMuncher	1
(CLOSED) Testdudetest	01/31/12	02/29/12	testdudetest	1
(CLOSED) CRAC	01/31/12	02/23/12	testdudetest	1
(CLOSED) Freestyle Design 80	01/31/12	02/09/12	kimdn	1
(CLOSED) test-contest	02/01/12	02/02/12	climax141	1
(CLOSED) chemchem111	02/01/12	02/02/12	nlite510	1
(CLOSED) leukaemia virus chain native matrix	02/01/12	08/27/12	GoshaDole	1
(CLOSED) Sandbox1	02/03/12	02/29/12	nlite510	1
(CLOSED) Sim-based Lifecycle Engineering	02/29/12	03/31/12	mxynidis	1
(CLOSED) Bio 152EC	02/06/12	02/16/12	smfuchs	1
(CLOSED) Freestyle Design: Variable Length	05/02/13	05/10/13	ligandfinder	1
(CLOSED) BIo152 EC	02/07/12	02/16/12	smfuchs	1
(CLOSED) erero7 challenge	02/08/12	02/29/12	erero7	1
(CLOSED) design your own protein	02/13/12	02/14/14	mberna00	1
(CLOSED) khfchlk 1	02/23/12	02/24/12	Solenopsis invicta	1
(CLOSED) CLEAN ME!!!!!!!!!!!!!!!!!	02/17/12	02/18/12	Bjamin	1
(CLOSED) hi	02/17/12	02/29/12	cyrusi	1
(CLOSED) hi2	02/18/12	03/01/12	cyrusi	1
(CLOSED) CASP Training	02/18/12	04/30/12	nealk	1
(CLOSED) C21ECL	02/21/12	02/25/12	lijiahua1984	1
(CLOSED) C21ECL-1	02/21/12	02/24/12	lijiahua1984	1
(CLOSED) Test contest	02/23/12	02/23/13	f1pokerspeed	1
(CLOSED) Test2	02/23/12	02/23/13	9ct29	1
(CLOSED) GTPase Ras test	02/29/12	04/30/12	oshirikajirimushi18th	1
(CLOSED) HIV protease test	03/01/12	05/01/12	oshirikajirimushi18th	1
(CLOSED) Tspan peptide 2	03/03/12	04/01/12	rwarn	1
(CLOSED) HIV Protease	03/05/12	03/01/13	dbuske	1
(CLOSED) Bioc WSC EC	03/06/12	03/07/12	jcnichols	1
(CLOSED) test	03/11/12	03/12/12	RedVenom	1
(CLOSED) Yu's lab C2E1	03/11/12	03/01/15	lijiahua1984	1
(CLOSED) Just playing around	03/13/12	03/20/12	wdherndon	1
(CLOSED) test	03/13/12	03/20/12	mk18	1
(CLOSED) For my students	03/16/12	03/23/12	GirichMS	1
(CLOSED) blabla	03/17/12	03/24/12	ccilia	1
(CLOSED) Freestyle 20	03/17/12	03/20/12	upquark	1
(CLOSED) For students	03/18/12	04/30/12	GirichMS	1
(CLOSED) For stud. 2	03/18/12	04/30/12	GirichMS	1
(CLOSED) For stud. 3	03/18/12	04/30/12	GirichMS	1
(CLOSED) This freestyle puzzle	03/18/12	04/30/12	GirichMS	1
(CLOSED) No. 4.	03/18/12	04/30/12	GirichMS	1
(CLOSED) No. 5	03/18/12	04/30/12	GirichMS	1
(CLOSED) No. 6	03/18/12	04/30/12	GirichMS	1
(CLOSED) Mat test	03/20/12	03/20/13	mat747	1
(CLOSED) first time	03/24/12	03/25/12	billyhuegel	1
(CLOSED) good luck	03/24/12	03/25/12	billyhuegel	1
(CLOSED) Cancer Treatment Contest	03/24/12	04/24/12	DaVinci21	1
(CLOSED) Freestyle Design 80	03/24/12	09/30/12	ofc2000	1
(CLOSED) clamp test	03/30/12	03/31/12	hilaryar	1
(CLOSED) Cameron	04/03/12	04/04/12	Cameron Baxendale	1
(CLOSED) Acyl Hydrolase	04/03/12	04/04/12	MichaelGasse	1
(CLOSED) Foamy Virus Gag protein	04/10/12	04/17/12	blutjoghurt	1
(CLOSED) BioClass	04/11/12	04/15/12	sarahod23	1
(CLOSED) Human Respiratory Syncytial Virus Attachment Protein (RSV G)	04/12/12	07/31/12	MiCu	1
(CLOSED) HIV test	04/11/12	04/13/12	SciShowFTW	1
(CLOSED) Go freestyle!	04/15/12	04/22/12	AsDawnBreaks	1
(CLOSED) PFV Gag	04/17/12	07/17/12	blutjoghurt	1
(CLOSED) Freestyle Design	04/22/12	04/30/14	michaeled314	1
(CLOSED) 40 Segment Chain	04/22/12	04/30/14	michaeled314	1
(CLOSED) Tiroler Nacht der Forschung	04/25/12	04/29/12	obiwan	1
(CLOSED) Tiroler Nacht der Forschung 2	04/25/12	04/29/12	obiwan	1
(CLOSED) Blarghs contest	04/30/12	12/31/12	blargh123	1
(CLOSED) LPDF Contest	04/30/12	05/03/12	maxionwimps	1
(CLOSED) GOVST BIOCHEMISTRY	05/07/12	12/17/12	govstbiochem	1
(CLOSED) rc013	05/09/12	05/31/12	jlmaccal	1
(CLOSED) HIV stinks.... yeah yeah	05/12/12	05/01/14	tweak64	1
(CLOSED) Marcus	05/17/12	05/20/12	mdaquino	1
(CLOSED) test test	05/19/12	05/20/12	Stolaf	1
(CLOSED) Ael	05/20/12	06/03/12	Aralys	1
(CLOSED) Knots	05/22/12	05/23/12	AsDawnBreaks	1
(CLOSED) 13-mer toxic peptides	05/23/12	05/31/12	hanhnguyen14	1
(CLOSED) Serine Proline Rich AfCNA	05/25/12	06/28/12	cookie2004	1
(CLOSED) Wolfer's Class 2	05/31/12	06/06/12	NTWII	1
(CLOSED) Test field 1	06/01/12	06/02/12	phi16	1
(CLOSED) Transmembrane Molecule Modelling	06/01/12	06/30/12	Beerwing	1
(CLOSED) N-GlnR	06/09/12	09/30/12	weihuachen5211	1
(CLOSED) SarNorA	06/12/12	07/12/12	docsaro	1
(CLOSED) Test Protein	06/12/12	06/12/13	kurenan	1
(CLOSED) Kumamolisin	06/13/12	07/31/15	drummerdude204	1
(CLOSED) Trm7	06/14/12	06/21/12	v0lfg0ng	1
(CLOSED) Design it	06/15/12	06/21/14	DustWitch	1
(CLOSED) Freestyle Design 40: For Learning LUA	06/24/12	06/30/15	gitwut.lua	1
(CLOSED) coolkids2 contest	07/06/12	07/07/12	meelock	1
(CLOSED) Just 4 fun	07/12/12	07/20/12	Josephdud66	1
(CLOSED) biocon	07/26/12	07/27/12	aurabum	1
(CLOSED) extended_design_tj	08/02/12	08/05/12	TJBrunette	1
(CLOSED) Beginner HIV protease	08/07/12	08/10/12	rarkenin	1
(CLOSED) Freestyle	08/16/12	08/30/12	Mytherus	1
(CLOSED) zhustb	08/26/12	08/25/13	chingsong	1
(CLOSED) virus	09/02/12	12/28/12	Aqua817	1
(CLOSED) Just for test	09/06/12	09/07/12	dyh	1
(CLOSED) the protein	09/07/12	09/26/15	river12345	1
(CLOSED) working in a mutate script	09/07/12	09/01/13	BitSpawn	1
(CLOSED) My first contest	09/14/12	09/30/12	SOARcdur	1
(CLOSED) GTPase pas puzzle	09/14/12	12/31/12	SOARcdur	1
(CLOSED) you betta win	09/19/12	09/23/12	SOARcmoo	1
(CLOSED) все надоемо	09/24/12	09/30/12	egik1997	1
(CLOSED) freestyle fun	09/26/12	12/31/12	saggyballs	1
(CLOSED) 40 aa class test	09/27/12	12/01/12	rsingiser	1
(CLOSED) Entamoeba insertion domain	10/06/12	10/12/13	lucnoken	1
(CLOSED) Rodrigo	10/08/12	10/16/15	Rodrigo999	1
(CLOSED) Cancer Puzzle	10/09/12	10/11/12	beta_helix	1
(CLOSED) Freestyle design 40	10/09/12	10/09/14	meatexplosion	1
(CLOSED) Freestyle design 20	10/09/12	10/09/14	meatexplosion	1
(CLOSED) Trichoplusia ni. Gloverin Protein	10/12/12	12/31/13	ainstein001	1
(CLOSED) Penn State Hershey BMS 504	10/15/12	10/28/12	iropson	1
(CLOSED) Frizzled Design Puzzle Contest - October PD	10/25/12	11/01/12	katievh	1
(CLOSED) freestyle test	10/27/12	10/28/12	Marek_Berlin	1
(CLOSED) Metallothionein	11/05/12	11/30/12	Phil.Pa	1
(CLOSED) Test Scripting - ZKora	11/08/12	11/30/12	ZKora	1
(CLOSED) AP Bio Puzzle 1	11/15/12	11/18/12	APTeach235	1
(CLOSED) Design 40	11/17/12	12/17/12	clptrsn	1
(CLOSED) hahhaaha cool.	11/19/12	11/23/12	joshlitchman	1
(CLOSED) marolidas sandbox	11/20/12	11/27/12	marolidas	1
(CLOSED) fire and rain	11/20/12	12/22/12	mattymoe	1
(CLOSED) fire and rain	11/20/12	12/22/12	mattymoe	1
(CLOSED) Black Nest of doom	11/23/12	12/31/12	mattymoe	1
(CLOSED) Frizzle	12/02/12	03/02/13	marie_s	1
(CLOSED) Streptococcus pneumoniae	12/02/12	12/31/12	Placebo	1
(CLOSED) Streptococcus pneumoniae 80	12/02/12	12/31/12	Placebo	1
(CLOSED) >R0023 SP18154A, Streptococcus pneumoniae, 100 residues MRAQSFFLTFSFIRSKIKLALNKGVLNMIEITYIDASKNERTVTFESYEDFERSQQACLI GVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN	12/02/12	12/10/12	margo311	1
(CLOSED) Everyone can join	12/03/12	01/16/13	junikl2	1
(CLOSED) HIV	12/05/12	12/29/12	Quxwozing	1
(CLOSED) Test 123	12/07/12	12/14/12	RicGray	1
(CLOSED) Spielwiese Freestyle Design 40	12/08/12	12/31/13	Bithalbierer	1
(CLOSED) bioinformatic task for exam	12/09/12	12/20/12	margo311	1
(CLOSED) 100 amino acids	12/09/12	12/20/12	margo311	1
(CLOSED) >R0023 SP18154A, Streptococcus pneumoniae, 100 residues	12/09/12	12/25/12	margo311	1
(CLOSED) Second part	12/10/12	12/24/12	Placebo	1
(CLOSED) Bio152	12/13/12	01/31/13	smfuchs	1
(CLOSED) Fastest person	12/13/12	12/22/12	ponies_rock	1
(CLOSED) FTN1438	12/19/12	12/31/13	nwabu1ao	1
(CLOSED) 11	12/20/12	01/29/13	ScottNDean	1
(CLOSED) Membrane receptor	12/20/12	02/28/13	ScottNDean	1
(CLOSED) Other receptor	12/20/12	12/14/13	ScottNDean	1
(CLOSED) go with the flow	12/23/12	12/30/12	Npereira	1
(CLOSED) Go with the flow 2	12/23/12	12/30/12	Npereira	1
(CLOSED) Stop The HIV Protease	12/28/12	12/31/12	Evaesion	1
(CLOSED) Freestyle Design (80 segments)	01/13/13	01/31/14	OrigamiMaster	1
(CLOSED) Testing Puzzle	01/15/13	01/31/13	thoyt2012	1
(CLOSED) feqf	01/21/13	01/17/15	jinguluninja	1
(CLOSED) Tau Protein (441 residue htau40)	01/23/13	12/31/16	jinguluninja	1
(CLOSED) test	01/24/13	01/01/14	sonneys	1
(CLOSED) ferer gerge	01/27/13	01/13/16	jinguluninja	1
(CLOSED) THE OCTAGON v2	02/07/13	02/08/13	nomatic	1
(CLOSED) gtpase ras	02/09/13	02/01/15	jjwinkle4740	1
(CLOSED) Drosophila Melanogaster nmd protein AAA superfamily	02/09/13	02/08/14	jjwinkle4740	1
(CLOSED) vgsetgethgtr rgwethg	02/14/13	02/14/16	oxyi	1
(CLOSED) scritterTest	02/15/13	02/28/13	scritter	1
(CLOSED) scritterTest2	02/15/13	02/28/13	scritter	1
(CLOSED) biochem assignment	02/16/13	02/15/14	sonneys	1
(CLOSED) Chicken Noodle Soup	02/17/13	06/22/13	mattymoe	1
(CLOSED) Tbf1	02/20/13	07/17/13	Rivsie	1
(CLOSED) Bioc S13 2nd chance	02/26/13	02/28/13	jcnichols	1
(CLOSED) thing	03/03/13	03/04/13	erek	1
(CLOSED) Biokemi contest	03/05/13	03/06/13	MagnusA	1
(CLOSED) Test	03/09/13	07/20/13	mind_hack	1
(CLOSED) HBV core protein	03/14/13	03/23/13	Tsogo	1
(CLOSED) Contest	03/17/13	03/18/13	CardsOverCoins	1
(CLOSED) ISHMIT DAHAL	03/18/13	03/19/13	USER2013	1
(CLOSED) For testing purposes	03/19/13	03/31/13	f00barbob	1
(CLOSED) a test of rich disordered seq	03/19/13	03/31/13	wangxinyu_cn	1
(CLOSED) Frizzled	03/21/13	03/23/13	beta_helix	1
(CLOSED) 3G	03/25/13	04/30/13	rvalensia	1
(CLOSED) Super Freestyle	03/27/13	04/27/13	super_Nethergirl	1
(CLOSED) Super Freestyle	03/27/13	04/27/13	super_Nethergirl	1
(CLOSED) hmm	04/07/13	04/09/13	MurloW	1
(CLOSED) hm	04/07/13	04/09/13	MurloW	1
(CLOSED) Freestyle Design Variable Length. 2 weeks	04/09/13	04/24/13	MurloW	1
(CLOSED) Multi-domain protein	04/10/13	07/10/13	pbartlow	1
(CLOSED) First molecule	04/12/13	04/13/13	gsandoval	1
(CLOSED) Freestyle 80 segment de-novo	04/22/13	04/27/13	wosser1	1
(CLOSED) Vandeweyer_Protein	04/22/13	04/30/13	gvandeweyer	1
(CLOSED) 5cDraw Gutstopen	04/22/13	04/27/13	ManVsYard	1
(CLOSED) P22-N	04/23/13	04/27/13	syoifczeri	1
(CLOSED) P22-N^W[Tb]	04/23/13	04/30/13	syoifczeri	1
(CLOSED) Freestyle Design 80	05/03/13	05/18/13	iqbalmahmud	1
(CLOSED) Small Hepatitis B Surface Antigen (HBsAg)	05/07/13	05/07/14	bigben446	1
(CLOSED) Test	05/12/13	05/17/13	MurloW	1
(CLOSED) testing own script	05/13/13	12/31/16	Morus	1
(CLOSED) Family and Friends	05/13/13	05/07/16	LunarEclipse	1
(CLOSED) ricg contest	05/17/13	05/18/13	RicGray	1
(CLOSED) peptide test	05/31/13	05/17/14	syoifczeri	1
(CLOSED) LOX enzyme from human	05/21/13	12/24/13	magnus groes	1
(CLOSED) Reinhardt Demo stuff	06/04/13	06/18/13	ReinhardtScience	1
(CLOSED) scienceteach test wee	06/04/13	06/18/13	ReinhardtScience	1
(CLOSED) FOlditExpo	06/06/13	06/11/13	ReinhardtScience1	1
(CLOSED) protein desgin	06/11/13	06/14/13	ctdevlin	1
(CLOSED) 59 chain protein	06/12/13	06/30/13	ctdevlin	1
(CLOSED) Start of Sumer HIV	06/19/13	06/26/13	nerdysib	1
(CLOSED) GTPase Ras	06/19/13	07/20/13	ChinaSESsolve	1
(CLOSED) PitA	07/16/13	08/10/13	canthony9	1
(CLOSED) Sorry, This is test	06/27/13	06/28/13	myputer	1
(CLOSED) prueba mioglobina	06/30/13	06/11/14	cmendo	1
(CLOSED) Just a puzzle	07/01/13	07/31/13	wisky	1
(CLOSED) e235wef	07/07/13	07/23/16	phallicies	1
(CLOSED) YneM	07/10/13	08/17/13	canthony9	1
(CLOSED) Acad Alignment Puzle	07/11/13	07/11/14	thomasjs223	1
(CLOSED) Freestyle Design 40	07/12/13	07/12/16	Sadler	1
(CLOSED) Freestyle Design 20	07/12/13	07/12/16	Sadler	1
(CLOSED) UNC SHARP Contest 2	07/12/13	07/31/13	jetaiken	1
(CLOSED) Virus Matrix	07/15/13	08/15/13	dbuske	1
(CLOSED) PfTLP	07/16/13	07/16/14	BNGSTE001	1
(CLOSED) Curing_Mad_Diseases_Bro	07/17/13	09/01/13	Cyren_Guerrero	1
(CLOSED) testcol4a3bp2	07/18/13	12/19/13	G_H_B	1
(CLOSED) Adam & Tyler	07/20/13	07/23/13	Adamdejesus	1
(CLOSED) Free test	07/29/13	08/23/13	eatfears	1
(CLOSED) how to make unknownyytw	07/29/13	07/31/13	chinatsu	1
(CLOSED) Debugger	08/05/13	08/11/13	Tadasu	1
(CLOSED) test	08/19/13	08/21/13	bkoep	1
(CLOSED) design test	08/19/13	08/21/13	bkoep	1
(CLOSED) Frizztest	08/20/13	08/31/13	spmm	1
(CLOSED) Small Dimer	08/22/13	08/29/13	spdenne	1
(CLOSED) SK SK	09/01/13	12/31/16	ScratchKid	1
(CLOSED) Spider silk design	09/01/13	12/31/16	Jirachi	1
(CLOSED) test dimer	09/03/13	09/06/13	jsorr	1
(CLOSED) Aptamers 1	09/04/13	12/31/13	Aiursfallen	1
Freestyle Design 80	09/15/13	09/15/20	Sadler	1
(CLOSED) NEAR contest	09/27/13	09/29/13	nyla12	1
(CLOSED) Small test protein	09/17/13	12/31/13	wudoo	1
(CLOSED) Small test protein 2	09/17/13	12/31/13	wudoo	1
(CLOSED) silk protein	09/22/13	09/13/14	danielgcc	1
(CLOSED) HIV	09/26/13	09/24/16	ScoobyHusky	1
(CLOSED) ELAV4_48_118	09/28/13	09/01/14	Panoramix	1
(CLOSED) hiv positive	10/03/13	10/04/13	Mhembrough	1
(CLOSED) Triple Helix DNA	10/03/13	10/31/15	Tovi	1
(CLOSED) Sandbox	10/05/13	10/19/13	creteen	1
(CLOSED) Trying to make a Propeller!	10/08/13	10/31/13	wisky	1
(CLOSED) GPCR Test	10/09/13	10/03/14	alathb	1
(CLOSED) easy	10/09/13	12/31/16	alex90	1
(CLOSED) Lab Sequence	10/16/13	10/01/14	Orangeutan	1
(CLOSED) Open Design Test	10/18/13	10/19/13	picklion	1
(CLOSED) utaca	10/25/13	11/15/16	utaca	1
(CLOSED) Design test	11/01/13	11/30/13	wisky	1
(CLOSED) Beginner Alignment Puzzle	11/03/13	11/30/13	Chris123	1
(CLOSED) Valentine's day	11/06/13	02/14/14	Compassionate	1
(CLOSED) Test Contest	11/06/13	01/31/14	Roukess	1
(CLOSED) test2	11/06/13	01/31/14	Roukess	1
(CLOSED) fun	11/21/13	12/31/16	ninjaeliot	1
(CLOSED) Yo dawg	11/25/13	11/30/13	HelloKittyIslandAdventure	1
(CLOSED) Obliged to try that!	12/01/13	02/28/14	Gabs_the_lil_protein	1
(CLOSED) IVa2	11/03/14	12/20/14	paul.kascak	1
(CLOSED) IVa2	11/14/14	11/30/14	paul.kascak	1
(CLOSED) IVa2	11/23/14	11/07/15	paul.kascak	1
(CLOSED) sang contesy	11/30/13	12/09/13	swl2013	1
(CLOSED) stress responsive protein [Porphyromonas gingivalis SJD2]	12/06/13	12/12/14	DashaDv	1
(CLOSED) Ligand Practice	12/07/13	12/16/13	slofgren	1
(CLOSED) 40 freestyle	12/09/13	12/05/16	DashaDv	1
(CLOSED) dimer test	12/09/13	12/15/16	syoifczeri	1
(CLOSED) Total freedom	12/09/13	12/10/13	ahaddad	1
(CLOSED) Protein Laboratory	12/10/13	12/25/13	slofgren	1
(CLOSED) trimer test	12/11/13	12/31/15	syoifczeri	1
(CLOSED) manners	12/21/13	02/28/14	Spark5	1
(CLOSED) ABCDEFG HIJK	12/21/13	01/05/14	Spark5	1
(CLOSED) Test 611	12/27/13	12/28/13	NickyCGS	1
(CLOSED) Trimer design	12/28/13	12/28/14	arivero	1
(CLOSED) popopop	12/28/13	12/31/13	swl2013	1
(CLOSED) Testing ground 3	12/30/13	12/30/14	slofgren	1
(CLOSED) Create-a-Protein I	01/04/14	01/11/14	PennyfromHeaven	1
(CLOSED) SaLLIa666 Game	01/08/14	01/12/14	SaLLIa666	1
(CLOSED) AIDS ATTACK	01/08/14	12/31/17	Luciana	1
(CLOSED) Sparky	01/09/14	03/09/14	Spark6	1
(CLOSED) carlos	01/18/14	01/19/14	phillida	1
(CLOSED) Urena	01/11/14	01/12/14	robertito	1
(CLOSED) MGC 2014	01/16/14	01/22/14	Kimbostu	1
(CLOSED) My 500 Test	01/17/14	02/24/14	BCAA	1
(CLOSED) R3	01/29/14	01/30/14	maverickandgoose	1
(CLOSED) Funny	02/01/14	04/06/14	Spark6	1
(CLOSED) test arla	02/07/14	02/14/14	arlap	1
(CLOSED) test arla 2	02/07/14	02/14/14	arlap	1
(CLOSED) ligand test	02/13/14	02/12/15	syoifczeri	1
(CLOSED) Test1212	02/14/14	02/15/14	NickyCGS	1
(CLOSED) Test1313	02/14/14	02/15/14	NickyCGS	1
(CLOSED) Test contest	02/14/14	02/15/14	NickyCGS	1
(CLOSED) D	02/17/14	02/24/14	MurloW	1
(CLOSED) Mean, lean, crumple machine	02/20/14	06/22/14	mind_hack	1
(CLOSED) mutate_test	02/25/14	04/25/14	robgee	1
(CLOSED) 1	02/26/14	02/27/14	egilleh	1
(CLOSED) Test	03/03/14	03/05/14	PeerPride	1
(CLOSED) Trest	03/02/14	03/13/14	PeerPride	1
(CLOSED) Freestyle Design 100 Sandbox	03/06/14	03/31/17	viosca	1
(CLOSED) AntProtFly	03/06/14	03/05/15	Flagg65a	1
(CLOSED) AntProtFly2	03/06/14	03/05/15	Flagg65a	1
(CLOSED) Raf kinase inhibitor	03/07/14	03/30/14	pongoo	1
(CLOSED) Biol. 312 project	03/10/14	04/29/14	Claire_Rinehart	1
(CLOSED) Freestyle 40	03/13/14	03/14/14	Shpooom	1
(CLOSED) IQS protein folding contest 2014	03/17/14	03/31/14	xevi.biarnes	1
(CLOSED) Freestyle Design 80	03/19/14	03/20/14	thoyt2012	1
(CLOSED) test20	03/20/14	03/20/17	Jean-Bob	1
(CLOSED) De Novo Folding of Auts2	03/24/14	06/24/14	ACastanza	1
(CLOSED) lost points test case	03/26/14	12/25/14	brgreening	1
(CLOSED) Test32714	03/27/14	03/28/14	NickyCGS	1
(CLOSED) Testmarch2714	03/27/14	03/28/14	NickyCGS	1
(CLOSED) Test 327	03/27/14	03/28/14	NickyCGS	1
(CLOSED) Test Contest 327	03/27/14	03/28/14	NickyCGS	1
(CLOSED) 702	04/01/14	06/29/14	csqu001	1
(CLOSED) 702	04/01/14	06/01/14	csqu001	1
(CLOSED) 80-2	04/09/14	04/16/14	test_account1	1
(CLOSED) 80-3	04/09/14	04/16/14	test_account1	1
(CLOSED) 500 for intermediate and beginning players	04/15/14	04/29/14	Andres186000@gmail.com	1
(CLOSED) Freestyle DC	04/23/14	05/28/14	spearandmagichelmet	1
(CLOSED) vlp de filette	04/23/14	05/31/14	alexram99	1
(CLOSED) Butt	04/24/14	04/25/14	dlaplaca	1
(CLOSED) test	04/25/14	04/26/14	kasper42	1
(CLOSED) lost points test two	04/25/14	04/25/17	brgreening	1
(CLOSED) Test 42514	04/25/14	04/26/14	NickyCGS	1
(CLOSED) design DNA?	04/29/14	04/30/16	kibakabul	1
(CLOSED) test frizzled	05/16/14	05/17/14	Seth Cooper	1
(CLOSED) Frizzled test	05/16/14	05/24/14	fankong	1
(CLOSED) test nanog	05/16/14	05/17/14	Seth Cooper	1
(CLOSED) test abeta	05/16/14	05/17/14	Seth Cooper	1
(CLOSED) test abeta 2	05/16/14	05/17/14	Seth Cooper	1
(CLOSED) indi 500 segment race	05/17/14	12/31/17	jeshprabakaran	1
(CLOSED) the	05/19/14	05/20/14	HAI-YU CHENG	1
(CLOSED) Test design	05/29/14	05/30/14	Valectar	1
(CLOSED) Testing200	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST1	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST2	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST3	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST4	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST5	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST6	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST7	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST8	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST9	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST10	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST11	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST12	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST13	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST14	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST15	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST16	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST17	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST18	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST19	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST20	05/30/14	05/31/14	NickyCGS	1
(CLOSED) ConTEST21	05/30/14	05/31/14	NickyCGS	1
(CLOSED) new test	06/03/14	06/04/14	test_account1	1
(CLOSED) Freestyle VarLength	06/08/14	06/30/14	Bithalbierer	1
(CLOSED) Myoglobin	06/08/14	06/15/14	Bithalbierer	1
(CLOSED) test100	06/10/14	06/11/14	Seth Cooper	1
(CLOSED) test150	06/10/14	06/11/14	Seth Cooper	1
(CLOSED) test200	06/10/14	06/11/14	Seth Cooper	1
(CLOSED) Fight Liver Cancer	06/12/14	12/31/14	retroneo	1
(CLOSED) prejudice on HIV	06/13/14	12/16/14	manasa	1
(CLOSED) Test Dimer	06/30/14	07/28/14	jflat06	1
(CLOSED) Test Trimer	06/30/14	07/28/14	jflat06	1
(CLOSED) DrCBDmon	06/15/14	06/30/14	angenentmari	1
(CLOSED) test nanog	06/17/14	06/18/14	test_account1	1
(CLOSED) lilovip01	06/22/14	07/22/14	lilovip	1
(CLOSED) Sandboxing, private pls	07/04/14	07/04/15	Thardus	1
(CLOSED) nanog	07/17/14	07/24/14	oli-popxD	1
(CLOSED) :P Fold it	07/25/14	08/09/14	I-Love-Computers	1
(CLOSED) hankg10	07/28/14	07/29/14	hankg10	1
(CLOSED) AZV 1	07/28/14	08/09/14	azvolpe	1
(CLOSED) Cux1 p110 Cleavage Domain, 440-753	08/12/14	08/19/14	antoine777	1
(CLOSED) Test	08/12/14	08/13/14	antoine777	1
(CLOSED) figure it out	08/14/14	08/18/14	crush2112	1
(CLOSED) HIV	08/15/14	06/30/15	Test Lab	1
(CLOSED) The National Protein Test	08/22/14	08/29/14	azak2002	1
(CLOSED) bZIP	08/28/14	09/18/14	sven1103	1
(CLOSED) test	09/27/14	06/25/15	srettie	1
(CLOSED) Small Peptides	09/27/14	11/30/14	Batz	1
(CLOSED) test	10/01/14	10/01/15	Orcus	1
(CLOSED) AMES #1 experement	10/07/14	10/31/14	foldase555	1
(CLOSED) AMES Science fair made me do it	10/07/14	10/31/14	foldase555	1
(CLOSED) foldit pro	10/08/14	10/09/14	otterballer	1
(CLOSED) vanabin	10/10/14	10/11/14	polli8	1
(CLOSED) Putative Plant Protein	10/10/14	10/31/14	Mecklenburger Friese	1
(CLOSED) Miso: a critical protein for mosquito reproduction	10/14/14	10/01/16	asmidler	1
(CLOSED) Miso try 2	10/14/14	10/01/17	asmidler	1
(CLOSED) Atg1 Protein	10/17/14	12/31/14	Mecklenburger Friese	1
(CLOSED) Hypotethical Protein ATU0225	10/21/14	10/09/15	gorrila13	1
(CLOSED) A#1284	10/22/14	11/30/14	Liam0289	1
(CLOSED) testing	10/31/14	11/01/14	ipcfg	1
(CLOSED) yo	10/31/14	11/01/14	otterballer	1
(CLOSED) Biotek Esp	11/04/14	11/11/14	Henriksk	1
(CLOSED) zincfingers	11/20/14	02/18/15	chingsong2	1
(CLOSED) course work test	11/21/14	12/31/14	chingsong	1
(CLOSED) TFP	11/21/14	12/31/14	chingsong2	1
(CLOSED) test 80 segment	11/23/14	11/26/15	brgreening	1
(CLOSED) 80 Segments Each	11/24/14	12/23/14	ElliottB1	1
(CLOSED) SH3PX1	11/25/14	02/28/15	Patrick1116	1
(CLOSED) design test	11/27/14	11/30/15	ipcfg	1
(CLOSED) First puzzle	11/29/14	12/03/14	r.gore	1
(CLOSED) dimer a-helix coiled-coil	11/29/14	12/05/14	r.gore	1
(CLOSED) RevDimer	12/04/14	12/05/14	Tanamura	1
(CLOSED) conTest	12/04/14	12/12/14	jflat06	1
(CLOSED) conTest2	12/04/14	12/12/14	jflat06	1
(CLOSED) Small test 20 segment	12/05/14	12/01/15	aninweton	1
(CLOSED) small test variable length	12/05/14	12/05/15	aninweton	1
(CLOSED) helix	12/09/14	12/31/15	ivalnic	1
(CLOSED) test	12/11/14	12/12/14	Bloch_Party	1
(CLOSED) test	12/12/14	12/13/14	bkoep	1
(CLOSED) my bioinfo assinment	01/17/15	02/12/15	c0d3w4rri0r	1
(CLOSED) my bio info assinment version 2	01/17/15	02/01/15	c0d3w4rri0r	1
(CLOSED) x	01/22/15	02/18/15	jakelmer	1
(CLOSED) Freestyle Design 40	01/27/15	01/31/18	HerobrinesArmy	1
(CLOSED) Freestyle Design 20	01/27/15	01/31/18	HerobrinesArmy	1
(CLOSED) Freestyle Design 40	01/30/15	12/31/15	Hutty	1
(CLOSED) Freestyle150	01/30/15	01/30/17	queentut16	1
(CLOSED) trial	02/04/15	02/08/15	jort	1
(CLOSED) normal contest	02/04/15	02/05/15	deephama001	1
(CLOSED) testmb	02/10/15	02/12/15	jakelmer	1
(CLOSED) Greek Key Test	02/11/15	03/11/15	kirkngrant	1
(CLOSED) mTOR	02/23/15	02/23/18	kurenan	1
(CLOSED) freestyle 20	02/24/15	02/24/16	manasa	1
(CLOSED) Porin	02/27/15	03/02/15	Jonathan51	1
(CLOSED) Private Contest	02/27/15	02/28/16	babacon	1
(CLOSED) test	03/03/15	03/04/15	boltax	1
(CLOSED) block II test	03/03/15	03/04/15	boltax	1
(CLOSED) protein 3AB [Enterovirus C]	03/08/15	05/08/15	orangejayo1	1
(CLOSED) Testing 150	03/09/15	03/27/15	HerobrinesArmy	1
(CLOSED) HBA1 Test	03/11/15	03/13/15	minecraft4ever4	1
(CLOSED) HBA1 Test2	03/11/15	03/12/15	minecraft4ever4	1
(CLOSED) dyfhyh yghdrh	03/11/15	03/15/15	minecraft4ever4	1
(CLOSED) Coiled Helices	03/30/15	04/04/15	Batz	1
(CLOSED) Freestyle Design 150	04/02/15	04/10/15	spacexplorer	1
(CLOSED) HBM	04/12/15	07/26/15	ChrisScientist	1
(CLOSED) a	04/06/15	04/14/15	jinxed	1
(CLOSED) linker	04/11/15	04/30/15	463418196@qq.com	1
(CLOSED) Trp-Cage	04/14/15	04/14/18	ivalnic	1
(CLOSED) P98	04/23/15	04/30/16	hphilipp	1
(CLOSED) aaa	04/26/15	05/15/15	mak3e	1
(CLOSED) Just For Begginers	04/29/15	04/30/15	timothyu120	1
(CLOSED) cenpH	05/07/15	08/07/15	josephab	1
(CLOSED) Check Cartesian Bug	05/11/15	06/30/15	brgreening	1
(CLOSED) helix test	05/18/15	05/27/15	dendixon	1
Hel	05/19/15	05/19/19	ivalnic	1
(CLOSED) bioinf	06/06/15	06/10/15	23RPE	1
(CLOSED) bioinf01	06/06/15	06/10/15	23RPE	1
(CLOSED) HIV protease BK	06/10/15	06/11/15	bkoep	1
(CLOSED) Freestyle Design 500	06/15/15	06/22/15	pipos1	1
Test contest for a project at TU Clausthal	06/20/15	06/21/18	Shanschke	1
Protein Folding with Point mutations	07/28/15	06/16/18	emernic	1
Freestyle 500	06/30/15	06/15/18	emernic	1
(CLOSED) Guanlin_HUST	07/03/15	07/03/16	Guanlinli	1
(CLOSED) Freestyle 40	07/07/15	07/08/15	LKluke	1
(CLOSED) Quinoa Test	07/09/15	07/31/15	dinoboy11	1
(CLOSED) Here we go	07/14/15	07/18/15	Unwise	1
(CLOSED) Freestyle Design 40	07/28/15	08/01/15	the wheat thin	1
(CLOSED) A4 test	07/30/15	08/04/15	rohtem	1
(CLOSED) Erv46 Kris	07/31/15	08/07/15	kristoferkeiser	1
(CLOSED) Final Project	08/04/15	08/31/15	megskene	1
lilovip-tests-02	08/05/15	08/31/18	lilovip	1
(CLOSED) test	08/13/15	08/14/15	sungwon	1
(CLOSED) Trial	08/17/15	08/20/15	OlgaRadchuk	1
(CLOSED) Duquesne PJAS 2	09/25/15	09/27/15	pink_cupcakes	1
(CLOSED) Duquesne PJAS 3	09/25/15	09/27/15	pink_cupcakes	1
(CLOSED) Duq Test	09/10/15	09/11/15	pink_cupcakes	1
(CLOSED) Oakwood Honors Bio Contest	09/17/15	09/30/15	elightrake	1
(CLOSED) test 1	09/23/15	10/31/15	honeypiebeatles	1
Happier	09/30/15	09/30/18	ferricst8	1
AtuJ1E6-cpGFP	10/01/15	10/31/18	Lemons	1
(CLOSED) Test DANIELLE	10/04/15	10/17/15	petetrig	1
(CLOSED) USTB work	10/09/15	10/10/15	chingsong	1
(CLOSED) Moe	10/21/15	10/01/16	ivalnic	1
(CLOSED) chase	10/28/15	10/29/15	ChaseLehr1234	1
(CLOSED) EC Fall15	10/30/15	11/15/15	jcnichols	1
(CLOSED) Test	11/08/15	11/30/15	Skulduggery	1
(CLOSED) test 2	11/09/15	12/25/15	Skulduggery	1
(CLOSED) Yay!	11/10/15	11/17/15	code cat	1
(CLOSED) outer envelope protein 80 [Arabidopsis thaliana]	11/11/15	01/06/16	swimbug2014	1
(CLOSED) Freestyle 80 Trimer	11/11/15	12/20/16	AryehK	1
(CLOSED) Test contest	11/23/15	11/24/15	seantan	1
(CLOSED) testing	12/04/15	12/08/15	vkalas	1
(CLOSED) invite only	12/04/15	12/04/16	vkalas	1
(CLOSED) SymmetryTest	12/07/15	12/08/15	Batz	1
(CLOSED) DIY Protein (A Big One)	12/11/15	12/31/15	Atombryan	1
(CLOSED) HIV solvers	12/31/15	04/01/16	Sammie123	1
(CLOSED) Freestyle Design	12/16/15	12/25/15	01010011111	1
(CLOSED) Freestyle Design 20	12/16/15	12/31/15	01010011111	1
(CLOSED) Contest Template Test	12/21/15	12/31/15	01010011111	1
(CLOSED) Merry post-christmas	12/25/15	12/28/15	-x-	1
(CLOSED) 161	12/26/15	12/31/15	shunsuketagami	1
(CLOSED) di trimmer ligand version	12/31/15	05/01/16	ChrisScientist	1
(CLOSED) ligamaze	12/31/15	03/31/16	ChrisScientist	1
(CLOSED) Freestyle Design 200	01/11/16	01/01/17	01010011111	1
(CLOSED) Freestyle Design 500	01/11/16	01/31/16	01010011111	1
(CLOSED) Freestyle Symmetric Design: 80 Trimer	01/15/16	01/31/16	01010011111	1
(CLOSED) Ice-structuring protein	02/01/16	02/29/16	Tajuton_potilas2	1
(CLOSED) peter and kim	02/03/16	04/02/16	petetrig	1
(CLOSED) peter and kim	02/03/16	06/11/16	petetrig	1
(CLOSED) Freestyle Design 20	02/08/16	02/29/16	01010011111	1
(CLOSED) Group V Biophysics BITSG	02/09/16	05/16/16	SandyVii	1
(CLOSED) AMP1	02/15/16	02/17/16	grubbybio	1
(CLOSED) Miami University	02/18/16	02/21/16	dirk41	1
Teste	02/25/16	02/12/19	NotEvenTryingM8	1
(CLOSED) Pseudomonas aeruginosa PA4063	02/28/16	03/31/16	mutinus	1
Freestyle Design 40	03/02/16	11/23/21	khendarg	1
Freestyle Design 20	03/02/16	01/01/30	khendarg	1
(CLOSED) HIV Protease	03/16/16	06/01/16	CureForDiabetes	1
(CLOSED) sgner1	04/07/16	04/08/16	sgner	1
(CLOSED) sgnerTEST	04/07/16	04/08/16	sgner	1
(CLOSED) Fomento CS	04/19/16	04/29/16	fomento00	1
(CLOSED) Baltyho prirozeni zda se byt smesne male	04/28/16	04/29/16	MMBP2016-HonJi	1
(CLOSED) ERN-Transmembran	04/29/16	04/30/16	zduzgun	1
(CLOSED) DENE	04/30/16	05/01/16	zduzgun	1
(CLOSED) Viral accessory protein	05/03/16	05/22/16	Zephrin	1
(CLOSED) Two symmetric chains, 40 segments each; all can be designed.	05/03/16	05/05/16	zduzgun	1
(CLOSED) Contest Template Test	05/04/16	05/06/16	zduzgun	1
(CLOSED) An 500 segment extended chain that can all be designed.	05/04/16	05/06/16	zduzgun	1
(CLOSED) This freestyle puzzle has mutable residues and allows you to add or delete residues	05/04/16	05/06/16	zduzgun	1
(CLOSED) Freestyle Design 20	05/09/16	05/29/16	01010011111	1
(CLOSED) Lac repressor	05/17/16	05/24/16	dunawayjacob	1
(CLOSED) test	07/12/16	07/13/16	guolab	1
(CLOSED) 1	07/22/16	07/23/16	liyixiao	1
(CLOSED) 20 segment extended chain that can all be designed.	07/27/16	08/12/16	01010011111	1
BendBobsPlayItYourWay	07/28/16	07/28/19	bendbob	1
(CLOSED) 1	08/04/16	08/06/16	rossco0407	1
(CLOSED) Practice_folding_from_scratch	08/22/16	12/01/16	Miguel.alj390	1
(CLOSED) TIM Barrel Design	08/29/16	09/02/16	Rsteele7	1
(CLOSED) TIM Barrel Design	08/29/16	09/02/16	Rsteele7	1
(CLOSED) TIM Barrel	09/01/16	09/09/16	Rsteele7	1
(CLOSED) TIM 200	09/01/16	09/09/16	Rsteele7	1
(CLOSED) Help Cure HIV	09/05/16	09/30/16	Toyo	1
(CLOSED) GTPase Ras	09/16/16	12/08/16	hgenzman21	1
(CLOSED) Biochem-AD16	09/23/16	10/07/16	Yocan	1
(CLOSED) LOL FU	09/30/16	10/30/16	BroC4	1
(CLOSED) test 1	09/27/16	09/29/16	ionickiwi	1
(CLOSED) Variable Length Protein Structure	09/29/16	12/31/16	Atombryan	1
(CLOSED) Sandbox	09/30/16	10/02/16	CollBio	1
(CLOSED) my contest	10/01/16	10/30/16	Carlos Santamaria	1
(CLOSED) Test	10/14/16	10/16/16	immac636	1
(CLOSED) raid	10/19/16	10/20/16	TheEnderCavalier	1
(CLOSED) biyokimya_2016_1.hafta	10/19/16	10/23/16	biyokimya_2016_ismailhoca	1
(CLOSED) deneme_1	10/19/16	10/20/16	ismailhakkiakgun	1
(CLOSED) ismailhakkiakgun	10/19/16	10/24/16	ismailhakkiakgun	1
(CLOSED) raid 2	10/20/16	10/21/16	TheEnderCavalier	1
(CLOSED) Breakfast of Champions	11/04/16	11/10/16	bowman1334	1
(CLOSED) Eric's Test	11/15/16	11/17/16	ebrenner14	1
(CLOSED) test-tintin-hiv	11/22/16	11/23/16	tintin1343	1
Practice Space--FREESTYLE: VARIABLE LENGTH	11/24/16	11/21/18	Puttering	1
Practice Space--SEAL MYOGLOBIN	11/24/16	11/21/18	Puttering	1
(CLOSED) Test	12/03/16	12/04/16	Justine18	1
(CLOSED) Adventure	12/03/16	12/04/16	Justine18	1
(CLOSED) BCH 441 Fold my protein contest	12/04/16	12/05/16	ryanolson41	1
SK SK II	12/04/16	12/31/19	ScratchKid	1
(CLOSED) abeta- binder	12/06/16	12/08/16	tintin1343	1
SK III!	12/07/16	12/31/19	ScratchKid	1
(CLOSED) BIOL1300/2300-2016 contest	12/09/16	12/31/16	nfawzi	1
SK V	12/29/16	12/31/19	ScratchKid	1
SK VI	12/29/16	12/31/19	ScratchKid	1
(CLOSED) SK VII	12/29/16	12/31/92	ScratchKid	1
(CLOSED) 1v Foldit 1	01/02/17	01/18/17	kipasceu	1
(CLOSED) TrollFace games	01/12/17	01/14/17	TrollFace2002	1
(CLOSED) Biochem 463 lab 1	01/24/17	01/25/17	BWeber	1
(CLOSED) i	01/27/17	01/30/17	zduzgun	1
SK VII	02/02/17	12/31/20	ScratchKid	1
(CLOSED) test contest	02/07/17	02/28/17	brbfold	1
Twelver	02/12/17	12/31/20	ScratchKid	1
erj	02/12/17	12/31/20	ScratchKid	1
iRFP	02/13/17	02/13/20	amao1	1
iRFP 2	02/13/17	02/13/20	amao1	1
(CLOSED) Test Contest for Lorna	02/17/17	02/19/17	dsilva.l	1
(CLOSED) axin solve	02/14/17	02/16/17	NiPatFeb2017	1
(CLOSED) #awesome	03/02/17	03/03/17	roachfamilymaine	1
(CLOSED) Test 3V1A	03/02/17	05/02/17	Scopper	1
(CLOSED) Freestyle Design 40 Contest #1	03/06/17	03/13/17	FutureScientist1212	1
(CLOSED) Freestyle Design 80 Contest #2	03/13/17	03/20/17	FutureScientist1212	1
(CLOSED) test	03/07/17	03/08/17	lhatsk	1
(CLOSED) Test	03/12/17	03/14/17	28SciOne	1
(CLOSED) Test2	03/12/17	03/19/17	28SciOne	1
(CLOSED) SEAL MYOGLOBIN	03/13/17	05/11/17	srinaldi1656	1
(CLOSED) Super Easy	04/01/17	05/03/17	AndriiMiller	1
(CLOSED) Chem 365?	04/02/17	04/30/17	koehlr60chem365	1
(CLOSED) Forf	04/10/17	04/11/17	Leser	1
(CLOSED) 200-residue design puzzle test	04/12/17	04/18/17	LociOiling	1
(CLOSED) Check	05/12/17	05/14/17	ProfCollins	1
(CLOSED) freestyle synthetic protein designs	06/12/17	07/12/17	jigs	1
(CLOSED) QQ	06/21/17	07/20/17	41607431	1
(CLOSED) freestyle 20	07/25/17	08/22/17	PatricioBato	1
(CLOSED) Freestyle 40	07/25/17	08/24/17	PatricioBato	1
(CLOSED) Chains!	08/03/17	09/02/17	Mao Mao	1
(CLOSED) Custom 500	08/07/17	09/06/17	khendarg	1
(CLOSED) Cell Bio	08/22/17	08/24/17	Dr.Chi	1
(CLOSED) testA1	08/24/17	08/25/17	ksz	1
(CLOSED) Freedom	09/13/17	09/14/17	LilinC33	1
(CLOSED) HIV Trouble	09/18/17	09/30/17	LOGOLOZ	1
(CLOSED) Ronny-test	09/22/17	09/30/17	ronnygeo	1
(CLOSED) Frestyle contest	10/04/17	10/08/17	maximiliancarey	1
(CLOSED) Test Custom Contest - dev03	10/09/17	10/12/17	ronnygeo	1
(CLOSED) Extracellular peptide	10/18/17	10/25/17	danielofs	1
(CLOSED) DONG1 protein	10/20/17	11/11/17	cxlpku	1
(CLOSED) test 1	10/20/17	10/31/17	cxlpku	1
(CLOSED) me and freinds	11/05/17	11/07/17	Nusayr	1
(CLOSED) test123	11/07/17	11/08/17	horowsah	1
(CLOSED) WTF! BOOM	12/01/17	12/03/17	DomasterPM	1
(CLOSED) Cool	12/02/17	01/01/18	BaiYang	1
(CLOSED) A Test Custom Contest - fold.it	12/29/17	12/31/17	Seth Cooper	1
(CLOSED) test9	12/29/17	12/30/17	horowsah	1
(CLOSED) name name	01/01/18	01/05/18	01010011111	1
(CLOSED) name 2	01/01/18	01/20/18	01010011111	1
(CLOSED) name 500	01/01/18	01/20/18	01010011111	1
(CLOSED) name 150	01/02/18	01/19/18	01010011111	1
(CLOSED) Noc Biologów test	01/09/18	01/12/18	decu	1
(CLOSED) test17	01/09/18	01/10/18	horowsah	1
(CLOSED) test18	01/09/18	01/10/18	horowsah	1
(CLOSED) test19	01/09/18	01/10/18	horowsah	1
(CLOSED) test20	01/09/18	01/10/18	horowsah	1
(CLOSED) test21	01/09/18	01/10/18	horowsah	1
(CLOSED) test22	01/09/18	01/10/18	horowsah	1
(CLOSED) test23	01/09/18	01/10/18	horowsah	1
(CLOSED) DUSP6	01/13/18	02/11/18	Bruno Kestemont	1
(CLOSED) DUSP6	01/13/18	02/11/18	Bruno Kestemont	1
(CLOSED) test	01/12/18	01/24/18	Uttkarsh	1
(CLOSED) test contest 04	01/13/18	01/31/18	josh04	1
(CLOSED) test for josh03	01/15/18	01/22/18	josh03	1
(CLOSED) testbibs	01/16/18	01/17/18	Addreoran	1
(CLOSED) Human Neuritin	01/25/18	02/24/18	Topo24	1
(CLOSED) test contest	02/05/18	02/08/18	samicheen	1
(CLOSED) Test custom contest	02/06/18	02/11/18	samicheen	1
(CLOSED) For Fun	02/12/18	03/12/18	srinaldi1656	1
(CLOSED) acka	02/15/18	03/17/18	rolfpf	1
(CLOSED) HIV	03/01/18	03/29/18	horowsah	1
(CLOSED) groel	03/01/18	03/29/18	horowsah	1
(CLOSED) enzyme	03/01/18	03/29/18	horowsah	1
(CLOSED) ADAM	02/28/18	03/27/18	psloliveira	1
(CLOSED) citodomain	02/28/18	03/27/18	psloliveira	1
(CLOSED) 2002949_0000_from_scooper	03/26/18	03/31/18	bkoep	1
(CLOSED) 2003169_S953	03/25/18	03/31/18	bkoep	1
(CLOSED) test17	04/05/18	04/06/18	horowsah	1
(CLOSED) test18	04/05/18	04/06/18	horowsah	1
(CLOSED) test19	04/05/18	04/06/18	horowsah	1
(CLOSED) cavs 49-30	04/06/18	04/13/18	2013345	1
CCBs-Next-TopModel	04/09/18	04/30/18	AnnaSophalK	1
(CLOSED) Turma 302 COLTEC	04/09/18	04/20/18	camiladlopes	1
(CLOSED) Desafio proteínas do HIV	04/09/18	04/20/18	camiladlopes	1
(CLOSED) biotek	04/10/18	04/13/18	Aminstrater	1
(CLOSED) 4bws test	04/11/18	04/13/18	bkoep	1
(CLOSED) test30	04/16/18	04/17/18	horowsah	1
(CLOSED) Another Contest	04/17/10	04/22/10	TheGUmmer	2
(CLOSED) Recipe tester	05/31/10	07/01/10	Datstandin	2
(CLOSED) Simpler recipe tester	05/31/10	06/30/10	Datstandin	2
(CLOSED) find the various aminos	07/06/10	12/31/10	smith92clone	2
(CLOSED) the grand final	08/17/10	12/31/13	cyclic3	2
(CLOSED) ygkas	08/13/13	08/17/14	sotk	2
(CLOSED) Dubons Class Contest	09/08/10	09/10/10	dubon1	2
(CLOSED) bjarke join mig	10/04/10	10/05/10	aske2010	2
(CLOSED) Open University Challenge	11/20/10	12/18/10	ilya.makedon	2
(CLOSED) BioContest	01/27/11	01/28/11	cbehling	2
(CLOSED) the only tournament here! (for now)	05/10/11	06/10/11	shrock	2
(CLOSED) TEST	06/14/11	06/18/11	csac1959	2
(CLOSED) contest	06/26/11	07/13/11	madpenguin	2
(CLOSED) GTPase Ras	09/23/11	10/07/11	Miah	2
(CLOSED) Michael and Marco	10/05/11	10/06/11	bigbanggd410	2
(CLOSED) TR624	10/25/11	11/06/11	beta_helix	2
(CLOSED) A Computer Tester	12/09/11	12/08/12	mat747	2
(CLOSED) BLARG	12/20/11	12/21/11	Chappers	2
(CLOSED) HIV protease	01/16/12	01/20/12	recondite7	2
(CLOSED) Some Test Contest	01/26/12	02/05/12	Biology-EtcManager	2
(CLOSED) love vs. love	02/22/12	02/24/12	k.love	2
(CLOSED) vroom2	02/24/12	03/24/12	kasmol	2
(CLOSED) TFS dwewf	04/03/12	04/04/12	jperoff	2
(CLOSED) Freestyle Design 500	04/16/12	04/29/12	drumpeter18yrs9yrs	2
(CLOSED) contest	04/22/12	04/24/12	yesir	2
(CLOSED) contest de foldit	05/15/12	05/18/12	Alakazam Einstein	2
(CLOSED) 33mer From Shan et. al.	05/23/12	06/30/12	scooper14	2
(CLOSED) tester	06/01/12	06/02/12	CharlieFortsConscience	2
(CLOSED) CASP9 Target 611 residue protein	06/18/12	06/18/13	meatexplosion	2
(CLOSED) Yes	07/24/12	07/25/12	JBrown2322	2
(CLOSED) Albert	11/13/12	11/14/12	Albert_tanjaya	2
(CLOSED) Black Nest of Doom	11/23/12	12/31/12	mattymoe	2
(CLOSED) fold it contest	11/29/12	11/30/12	ylecroy	2
(CLOSED) cancer help	12/06/12	12/31/13	jordansapp1	2
(CLOSED) ww domain	01/08/13	01/31/13	deans	2
(CLOSED) fahdkabani	02/20/13	02/21/13	fahdkabani	2
(CLOSED) pechi demo	03/03/13	06/07/13	anthunk	2
(CLOSED) Elijahs contest	03/08/13	03/31/13	ilikediamonds	2
(CLOSED) Moar Freestyle Design. 80 seg, 1 week	03/26/13	04/02/13	MurloW	2
(CLOSED) Biotech WFB 1	03/28/13	04/09/13	KBrown	2
(CLOSED) Wisks Contest	04/06/13	04/30/13	WiskIRC	2
(CLOSED) Adam & Tyler	07/20/13	07/23/13	Adamdejesus	2
(CLOSED) Science aids	08/09/13	08/12/13	sience geek	2
(CLOSED) Solve for Treatment	08/30/13	09/10/13	PirateX12	2
(CLOSED) SK SK	09/01/13	12/31/16	ScratchKid	2
(CLOSED) 1 week Freestyle 80seg Trimer Design	08/30/13	09/06/13	MurloW	2
(CLOSED) BIIN351_1	09/04/13	09/18/13	ash	2
(CLOSED) Contest	10/25/13	10/27/13	DDarling	2
(CLOSED) what is this???	12/02/13	12/05/13	Niiikola	2
(CLOSED) Polite	12/21/13	04/25/14	Spark5	2
(CLOSED) testing Foldit minimize split intein 3NZM	01/02/14	01/02/16	sagearbor	2
(CLOSED) carlos	01/10/14	01/11/14	bharani94	2
(CLOSED) test	02/12/14	02/13/14	l_like	2
(CLOSED) jhdfksaufsahkmd	02/28/14	03/02/14	spider876	2
(CLOSED) test 80 trimer 327	03/27/14	03/28/14	NickyCGS	2
(CLOSED) 40-2	04/09/14	04/16/14	test_account1	2
(CLOSED) 40-3	04/09/14	04/16/14	test_account1	2
(CLOSED) Test, festyn bibs	05/15/14	05/19/14	Behoston	2
(CLOSED) Dino contest	05/14/14	05/15/14	isabelfer	2
(CLOSED) Abeta Binder Piecewise Design	05/30/14	06/21/14	fankong	2
(CLOSED) FirstTry	10/15/14	10/17/14	Waverka.10	2
(CLOSED) TFP200	11/25/14	12/31/14	chingsong2	2
(CLOSED) Design_test	12/03/14	12/04/14	bkoep	2
(CLOSED) Michael	04/26/15	04/28/16	jinxed	2
(CLOSED) Contest #1	05/30/15	05/30/16	pizpot	2
(CLOSED) Chem2208	10/02/15	10/03/15	u5586300	2
(CLOSED) yoyoyo	10/24/15	12/03/15	Aria Deng	2
(CLOSED) easron	11/16/15	11/17/15	EastonSickels1234	2
(CLOSED) Leishmania donovani Ornithine decarboxylase	11/20/15	11/25/15	mikroplasma	2
(CLOSED) 3. y biometrix	11/30/15	11/30/16	blomsterman	2
(CLOSED) JJT twincombo	11/30/15	01/31/16	Canadian KId	2
(CLOSED) Easy DIY Protein (For more precision then the other one)	12/11/15	12/31/15	Atombryan	2
(CLOSED) WSU Bioc Fall 16	10/20/16	11/03/16	jcnichols	2
(CLOSED) MC&SDRocks	02/27/17	02/24/18	SunSalutation	2
(CLOSED) Team 11 Test	03/18/17	03/19/17	50SciOne	2
(CLOSED) testComm	07/22/17	08/20/17	dsilva.l	2
(CLOSED) Global	12/16/17	12/17/17	ckluo	2
(CLOSED) phosphate	03/01/18	03/29/18	horowsah	2
(CLOSED) 40 Seg Design Contest	04/15/10	04/20/10	TheGUmmer	3
(CLOSED) testing the contest	04/15/10	05/15/10	mat747	3
(CLOSED) Crashguard303 Script test	06/07/10	06/14/10	Crashguard303	3
(CLOSED) Freestyle for all	11/01/10	12/05/10	thosi	3
(CLOSED) SBG	02/18/11	02/19/11	crma	3
(CLOSED) Ligand Practice	05/24/11	09/11/11	tyler0911	3
(CLOSED) UCSF DNA Challenge	10/25/11	11/06/11	beta_helix	3
(CLOSED) Montcrest	12/20/11	01/31/12	Chappers	3
(CLOSED) ligan practice -open to all	03/21/12	03/31/12	Mike Tate	3
(CLOSED) (Closed) PEP Private Contest III	05/22/12	05/31/12	prolylendopeptidase	3
(CLOSED) Dana_Nicolo	04/17/12	04/18/12	dananumber13	3
(CLOSED) Common Immunogenic Substrate (Fragment)	05/23/12	06/30/12	scooper14	3
(CLOSED) 500 residue freestyle!	08/16/12	08/20/14	meatexplosion	3
(CLOSED) Malaria Puzzle	10/09/12	10/11/12	beta_helix	3
(CLOSED) Flu Puzzle	10/09/12	10/11/12	beta_helix	3
(CLOSED) BCHS3201	02/20/13	02/25/13	fahdkabani	3
(CLOSED) Bioc 2nd chance (S13)	02/28/13	03/02/13	jcnichols	3
(CLOSED) UCDS Test Contest	03/25/13	04/30/13	UCDS_Test	3
(CLOSED) 40 segment Freestyle Design. 2 weeks.	03/22/13	04/06/13	MurloW	3
(CLOSED) SMIM1	03/24/13	03/31/13	gestur	3
(CLOSED) Beginner Alignment Puzzle Sup'Biotech	07/12/13	07/13/13	Darksliver	3
(CLOSED) UNC SHARP Contest 1	07/12/13	07/31/13	jetaiken	3
(CLOSED) Investigate Inspect Test	08/20/13	08/21/13	NickyCGS	3
(CLOSED) Abeta contest CampBIOmed	07/09/14	07/11/14	kaurg	3
(CLOSED) Nanog Transcription factor contest	07/29/14	07/31/14	kaurg	3
(CLOSED) Flute lets go son	09/30/14	10/01/14	FluteJasonKarakaedos	3
(CLOSED) MedChem14	10/16/14	10/27/14	pedrofong	3
(CLOSED) Lets have fun	01/11/15	01/13/15	imenm	3
(CLOSED) the ice dragons playhouse	02/06/15	02/28/15	the ice dragon	3
(CLOSED) test	02/10/15	02/10/16	silverberg	3
(CLOSED) Greek Key V2.0	03/30/15	04/15/15	jakelmer	3
(CLOSED) PRACTICE TEST 1	12/08/15	12/09/15	seantan	3
(CLOSED) PRACTICE TEST 2	12/08/15	12/09/15	seantan	3
(CLOSED) Contest	04/14/16	04/15/16	mxwly	3
(CLOSED) Test Contest - ML	05/01/16	08/31/16	MrMark2014	3
(CLOSED) My Contest	11/04/16	11/05/16	Benbennett2000	3
(CLOSED) contest	08/01/17	08/31/17	folditguy123098	3
(CLOSED) Lol tuturial	02/20/18	02/21/18	danielvan1994	3
(CLOSED) 2002949_0000	03/25/18	04/22/18	bkoep	3
(CLOSED) CASP9 611 residue	05/29/10	06/15/10	Mark-	4
(CLOSED) New small test	06/17/10	07/30/10	Crashguard303	4
(CLOSED) Script test ligand	10/20/10	01/31/11	Crashguard303	4
(CLOSED) Alignment battle	12/12/10	12/31/10	Nikaeo	4
(CLOSED) Histone H1	01/03/11	01/31/11	Dj-P	4
(CLOSED) 2011-11 small Freestyle	02/22/11	12/31/11	Crashguard303	4
(CLOSED) Freestyle Design 500	04/28/11	05/31/11	Acida-2	4
(CLOSED) Freestyle Design - 80 (Anthropic Dreams team members)	06/17/11	06/22/11	Seagat2011	4
(CLOSED) LETSGO	08/26/11	08/27/11	wudoo	4
(CLOSED) the contest	10/21/11	10/28/11	Mozzi	4
(CLOSED) Polish Contest	11/20/11	12/20/11	Mojzesz	4
(CLOSED) Spielwiese - Freestyle Design (Variable Length)	12/25/11	03/31/12	Bithalbierer	4
(CLOSED) Moloney Murine Leukaemia Virus Matrix Protein	02/01/12	02/03/12	beta_helix	4
(CLOSED) H3 Hemagglutinin Flu Design Puzzle	02/01/12	02/03/12	beta_helix	4
(CLOSED) (Closed) PEP Private Contest II	04/12/12	04/18/12	prolylendopeptidase	4
(CLOSED) Wolfer's Class	05/31/12	06/06/12	NTWII	4
(CLOSED) A london Olympic contest!	08/05/12	08/12/12	junh821	4
(CLOSED) 2 weeks, 80 segment design.	04/27/13	05/11/13	MurloW	4
(CLOSED) test	07/04/13	07/05/13	Raphsup	4
(CLOSED) Sup'BioFold	07/04/13	07/05/13	Darksliver	4
(CLOSED) ABETA PROTEIN COMPETITION	07/29/14	08/01/14	kaurg	4
(CLOSED) Hiv	12/07/14	12/01/15	dbuske	4
(CLOSED) Real Oakwood Honors Bio Contest	09/17/15	09/30/15	elightrake	4
(CLOSED) SHS	11/20/15	11/21/15	fanerdbcshs	4
(CLOSED) Miniprotein1L2Y	04/23/17	05/23/17	Bruno Kestemont	4
(CLOSED) Science One Team 10 Project	03/20/17	04/01/17	06SciOne	4
(CLOSED) Twisting of the protein (v.2)	01/01/11	01/31/11	Dj-P	5
(CLOSED) Compbio	08/22/11	08/23/11	hahnbeom	5
(CLOSED) Compbio2	08/22/11	08/23/11	hahnbeom	5
(CLOSED) Compbio3	08/22/11	08/23/11	hahnbeom	5
(CLOSED) Compbio4	08/22/11	08/23/11	hahnbeom	5
(CLOSED) Join if u Dare	04/26/13	04/20/14	srgp2012	5
(CLOSED) Camp BIOmed 2015 Week1	07/06/15	07/10/15	apklock	5
(CLOSED) Camp BIOmed 2015 Week2	07/13/15	07/17/15	apklock	5
(CLOSED) Team 5 Project	03/12/17	03/31/17	28SciOne	5
(CLOSED) team 6!!	03/21/17	03/25/17	20SciOne	5
(CLOSED) Mr Faure 1v1 me lmao 100XDDDDDDDDDDD	11/14/17	11/15/17	B0B0	5
(CLOSED) PM_2	01/18/18	01/27/18	PM_KSienkiewicz	5
(CLOSED) Script test III	08/12/10	10/12/10	Crashguard303	6
(CLOSED) AP BIO Extra Credit	09/24/10	09/25/10	jesalomone11	6
(CLOSED) Knotfind on	12/10/11	12/31/11	beta_helix	6
(CLOSED) Adelphi FHB Design	05/02/13	05/12/13	ligandfinder	6
(CLOSED) Long links	04/21/12	04/30/12	AsDawnBreaks	6
(CLOSED) DSSP algorithm vs NR data base	05/29/12	06/29/12	BitSpawn	6
(CLOSED) Testing puzzle	06/03/12	10/03/12	Ch Garnier	6
(CLOSED) Toxic Gluten Molecule	07/11/12	07/29/12	scooper14	6
(CLOSED) Toxic Gluten Peptide	07/11/12	07/29/12	scooper14	6
(CLOSED) Sugar Binding Puzzle	07/24/12	07/30/12	beta_helix	6
(CLOSED) HIV protease - BIOL225	01/16/14	01/22/14	Kimbostu	6
(CLOSED) Red Block 2 \| The Foldit Games	01/30/14	02/07/14	xXF4T3D_P4R4D0Xx	6
(CLOSED) Camp BIOmed NANOG contest	08/11/14	08/13/14	kaurg24	6
(CLOSED) Amyloid Beta contest - CampBIOmed	08/12/14	08/14/14	kaurg24	6
(CLOSED) Camp BIOmed week 4	07/27/15	07/31/15	apklock	6
(CLOSED) Week 5 Camp BIOmed	08/03/15	08/07/15	apklock	6
(CLOSED) King of the Class	12/10/15	12/11/15	crostomily	6
(CLOSED) DuquesnePJAS1	09/23/16	09/25/16	EmilyB	6
(CLOSED) DuquesnePJAS2	09/23/16	09/25/16	EmilyB	6
(CLOSED) DuquesnePJAS3	09/23/16	09/25/16	EmilyB	6
(CLOSED) HIV Protease Folding	05/10/17	05/13/17	Komsomolez	6
(CLOSED) Chem 2225 Spring 2011 Contest	03/09/11	03/31/11	brian.parker	7
(CLOSED) Alignment tool (join link in desc)	10/26/11	12/31/11	riking	7
(CLOSED) HIV	12/20/11	01/31/12	Chappers	7
(CLOSED) Spielwiese - HIV Protease	12/25/11	03/31/12	Bithalbierer	7
(CLOSED) Homology Modeling Course: HIV Protease	06/12/12	06/15/12	obiwan	7
(CLOSED) DR.B JWU BIOCHEM Contest-HIV protease	01/08/13	02/17/13	drmbudziszek	7
(CLOSED) Biostructure Contest	05/07/14	05/08/14	Komsomolez	7
(CLOSED) Abeta protein CampBIOmed	07/15/14	07/20/14	kaurg	7
(CLOSED) C4lab-Friendly Contest	11/04/14	11/23/14	yi-an Tung	7
(CLOSED) killen	04/23/15	04/24/15	woops	7
(CLOSED) BF Mol Dynamics	05/22/15	05/25/15	Ivelina Zaharieva	7
(CLOSED) Camp BIOmed 2015 Week 7	08/17/15	08/21/15	apklock	7
(CLOSED) BC 124	11/30/16	12/06/16	roandavila	7
(CLOSED) MGC - 2017	01/18/17	01/24/17	Kimbostu	7
(CLOSED) F20 for testing	12/24/10	02/28/11	Rav3n_pl	8
(CLOSED) Freestyle	10/08/12	10/07/13	asdf9	8
(CLOSED) Freestyle Variable Length. 1 month.	02/26/13	03/25/13	MurloW	8
(CLOSED) The Final Model	05/15/13	05/16/13	WheeDhee	8
(CLOSED) Best holiday design	12/21/14	12/31/14	Skippysk8s	8
(CLOSED) Practice Contest	12/10/15	12/11/15	crostomily	8
(CLOSED) DU Phosphorous 2018	01/11/18	01/26/18	horowsah	8
(CLOSED) Homology_Praktikum_IBK_SS11	06/16/11	06/20/11	csac1959	9
(CLOSED) more thunk testing	03/29/12	06/30/12	anthunk	9
(CLOSED) nmd AAA ATPase	02/09/13	02/08/14	jjwinkle4740	9
(CLOSED) free style 101	12/02/13	12/25/13	Jaceno	9
(CLOSED) BIOL225 2014	01/16/14	01/22/14	Kimbostu	9
(CLOSED) We are bored - Design Trimer Contest	08/02/15	08/16/15	jamiexq	9
(CLOSED) Duquesne PJAS 1	09/25/15	09/27/15	pink_cupcakes	9
(CLOSED) University of Edinburgh Biophysical chemistry workshop 2017	03/21/17	07/01/17	jmichel80	9
(CLOSED) 3V1A	04/23/17	05/23/17	Bruno Kestemont	9
(CLOSED) Structural-Bioinformatics	04/24/17	05/08/17	AnnaSophalK	9
(CLOSED) Bio-Tech 2k17	10/20/17	10/21/17	JosephNi	9
(CLOSED) Why not, really?	12/22/10	01/22/11	anthunk	10
(CLOSED) 80 segment freestyle design. 1 month.	01/29/13	02/28/13	MurloW	10
(CLOSED) Supbiotech A	04/24/14	04/25/14	ChloeAudrey	10
(CLOSED) Nanog Transcription Factor Contest - CampBIOmed	07/15/14	07/16/14	kaurg	10
(CLOSED) DU TAR 2018	01/11/18	02/02/18	horowsah	10
(CLOSED) DU Chaperone 2018	01/11/18	02/09/18	horowsah	10
(CLOSED) DU Enzyme 2018	01/17/18	02/16/18	horowsah	10
(CLOSED) CH 410 EC	02/09/18	03/09/18	ProfCollins	10
(CLOSED) DU AB 2018	02/12/18	03/12/18	horowsah	10
(CLOSED) Twisting of the protein (v1.0)	12/28/10	04/15/11	Dj-P	11
(CLOSED) Script testing	11/23/12	12/31/15	Jean-Bob	11
(CLOSED) Clayton Biochemistry Spring 2014	02/24/14	05/01/14	rsingiser	11
(CLOSED) HIV protease	03/27/14	04/04/14	Professor West	11
(CLOSED) HIV Protease - BIOL225	01/22/15	01/29/15	Siderhurst	11
(CLOSED) HIV protease - BIOL225	01/28/16	02/04/16	Siderhurst	11
(CLOSED) Collins CH 410	02/01/17	05/10/17	ProfCollins	11
(CLOSED) Werncs	12/07/17	12/08/17	caitlin@newcitycharterschool.org	11
(CLOSED) PM_PEGAZ	03/20/18	03/31/18	PM_KSienkiewicz	11
(CLOSED) Time to Cure Cancer- Once and For All!	03/01/11	06/01/11	tyler0911	12
(CLOSED) biol200-3-23-11	04/04/11	04/09/11	gabhsa	12
(CLOSED) Server models for T0743 Contest	10/13/12	05/13/13	Ch Garnier	12
(CLOSED) Wulff's Fantastic Core Challenge	01/27/14	02/28/14	-Jacoby-	12
(CLOSED) Sup'bio02	04/24/14	04/27/14	isaa54	12
(CLOSED) Greek Key Challenge	01/25/15	02/10/15	jakelmer	12
(CLOSED) Biophysical chemistry workshop - University of Edinburgh	02/08/16	04/25/16	jmichel80	12
(CLOSED) Chem 1307 Spring 2011 Contest	03/09/11	03/31/11	brian.parker	13
(CLOSED) Noc Biologow 2018 WB UW	01/12/18	01/13/18	decu	13
(CLOSED) WSC Bioc1 S18 EC	04/02/18	04/22/18	jcnichols	13
(CLOSED) CASP 9: Nycticorax nycticorax's mystery.	01/01/11	01/15/11	Dj-P	14
(CLOSED) SEAL MYOGLOBIN	11/23/11	01/31/12	Ch Garnier	14
(CLOSED) Two Day Beat Back the Boredom Puzzle	01/24/13	01/26/13	auntdeen	14
(CLOSED) New_contest	11/07/14	12/09/14	pedrofong	14
(CLOSED) Frizzled Design Contest	11/30/14	12/06/14	ingoneato	14
(CLOSED) Exam 2 EC Spring 2015	03/27/15	04/05/15	jcnichols	14
(CLOSED) EC Fall15	10/29/15	11/15/15	jcnichols	14
(CLOSED) Biochem 1 Extra Credit	11/17/17	12/15/17	ProfCollins	14
(CLOSED) Biophysical chemistry workshop University of Edinburgh	01/12/18	02/11/18	jmichel80	14
(CLOSED) Acida's test	09/22/10	09/30/10	Acida-2	15
(CLOSED) 3 day speed folding	01/24/13	01/27/13	jamiexq	15
(CLOSED) Clayton Biochemistry Summer 13	07/03/13	07/24/13	rsingiser	15
(CLOSED) CH 410 Puzzle 1	11/30/16	12/13/16	ProfCollins	15
(CLOSED) CHE 8592 Greek Key Challenge	02/09/17	02/16/17	jakelmer	15
(CLOSED) WSC Bioc 1 F17 EC	11/03/17	11/18/17	jcnichols	15
(CLOSED) Biophysical chemistry workshop University of Edinburgh Test	12/19/14	12/03/15	jmichel80	16
(CLOSED) WSU Bioc 1 S18	04/05/17	04/23/17	jcnichols	16
(CLOSED) Bioinfor Kaset	09/19/10	09/27/10	kiattawee	17
(CLOSED) Clayton Biochemistry Fall 12	09/30/12	12/01/12	rsingiser	17
(CLOSED) Multi-Start Bacteroides Vulgatus Contest	10/13/12	04/13/13	Ch Garnier	17
(CLOSED) Frizzled Design because we are bored	01/24/13	01/27/13	jamiexq	17
(CLOSED) Foldit tura pierwsza	05/23/14	05/25/14	Behoston	17
(CLOSED) WSU Fall 16 Biochemistry	11/02/16	11/20/16	jcnichols	17
(CLOSED) bioc_3	01/26/12	02/14/12	bkuhlman	18
(CLOSED) Bioc EC #2	10/16/12	10/17/12	jcnichols	18
(CLOSED) WSC Bioc Spring 2016	03/25/16	04/10/16	jcnichols	18
(CLOSED) bioc_670_design	02/01/12	02/15/12	bkuhlman	19
(CLOSED) SEAL MYOGLOBIN	05/25/12	11/25/12	Ch Garnier	19
(CLOSED) Another Beat Back the Boredom Old Style	01/24/13	01/26/13	auntdeen	19
(CLOSED) MPI	10/31/13	11/30/13	Mengzzz	19
(CLOSED) Align-it	08/14/10	08/21/10	Arbot360	20
(CLOSED) HIV protease	09/17/10	09/18/10	skoddet1	20
(CLOSED) You choose the number of residues	02/11/15	02/28/18	michaeled314	20
(CLOSED) BIOL1300/2300 Abeta binder	12/12/16	12/31/16	biol1300_nick	20
(CLOSED) UCSF Intro Puzzle	10/21/11	10/25/11	beta_helix	21
(CLOSED) BIOL1300/2300 Frizzled	12/12/16	12/31/16	biol1300_nick	21
(CLOSED) Sandbox puzzle for CASP9	05/02/10	05/19/10	beta_helix	22
(CLOSED) The Marathon of Foldit: 611 residues big puzzle chalenge	12/03/13	12/02/16	Bruno Kestemont	22
(CLOSED) Ligand Folding Practice- Open to all	05/01/11	09/01/11	tyler0911	23
(CLOSED) Test Puzzle to Fix Client	02/08/12	02/29/12	beta_helix	23
(CLOSED) Bioc670_1	01/22/11	02/10/11	bkuhlman	24
(CLOSED) SAC Summer 2012 OChem Challenge	06/04/12	06/10/12	brian.parker	24
(CLOSED) UCDS April Contest	04/01/13	04/30/13	UCDS_A0	24
(CLOSED) 'Brave New World' Class Puzzle	04/22/10	05/02/10	beta_helix	25
(CLOSED) Clayton Biochemistry Spring 13	02/25/13	05/05/13	rsingiser	25
(CLOSED) Bioc WSC	03/06/12	03/08/12	jcnichols	27
(CLOSED) Bioc WSC EC	03/25/12	03/31/12	jcnichols	27
(CLOSED) Penn State Hershey BMS 504 Contest 2	10/15/12	10/28/12	iropson	27
(CLOSED) coursework	11/20/14	12/31/14	chingsong	27
(CLOSED) Chem 431 contest	08/24/11	09/19/11	laurabee	28
(CLOSED) Flu Puzzle Competition	10/09/12	10/11/12	beta_helix	28
(CLOSED) Client Tests	12/04/13	12/31/16	Matthew Krueger	28
(CLOSED) HIV fight!	08/22/10	08/31/10	Rav3n_pl	29
(CLOSED) Moloney Murine Leukaemia Virus Matrix Protein	02/14/12	05/15/12	Ch Garnier	29
(CLOSED) USTB2017	11/29/17	12/29/17	chingsong	29
(CLOSED) Bioc F12 EC#1	10/11/12	10/15/12	jcnichols	30
(CLOSED) Bioc EC Fall 2014	10/28/14	11/15/14	jcnichols	32
Frizzled Design Puzzle Contest	02/11/15	12/31/18	michaeled314	32
(CLOSED) Nanog Homeobox Protein (NANOG)	03/07/12	03/07/13	Ch Garnier	34
(CLOSED) Anyone can join, HIV Protease, OPEN TO ALL	01/06/13	02/10/13	Phillipthegreat	34
(CLOSED) WSU Bioc (S13)	02/18/13	02/20/13	jcnichols	37
(CLOSED) Pace Academy 2014 HIV protease	08/21/13	12/21/13	thattori	37
(CLOSED) Extra credit for exam	10/23/13	10/31/13	jcnichols	37
(CLOSED) test	04/16/12	04/22/12	test_account1	41
(CLOSED) Freestyle Design a 500 length Protein!	12/09/13	12/31/16	Matthew Krueger	43
(CLOSED) Back to the Future	04/18/17	05/16/17	chingsong	43
(CLOSED) New City Charter School	12/09/17	12/10/17	caitlin@newcitycharterschool.org	43
(CLOSED) 200 Residue Freestyle!	08/21/13	08/21/14	meatexplosion	44
(CLOSED) No Peeking - Immediately drag puzzle off screen when beginning. Players should NEVER see the protein.	06/01/12	06/30/12	phi16	46
(CLOSED) BIOC530	12/04/14	12/12/14	bkoep	46
(CLOSED) Foldit University Challenge	11/05/10	11/19/10	ilya.makedon	47
(CLOSED) HIV protease sandbox	05/04/11	05/01/14	tyler0911	49
(CLOSED) Open 500 Segment design puzzle	09/09/12	12/31/15	Ryanfav	49
(CLOSED) Freestyle Design this 500 residue protein - Seagat2011	12/17/10	01/14/12	Seagat2011	50
(CLOSED) Educurious Frizzled Design Puzzle Contest!	02/10/13	03/31/13	katievh	51
(CLOSED) GeneDesign	03/08/18	04/07/18	chingsong	55
(CLOSED) Test your PC power	12/03/13	09/30/16	Bruno Kestemont	59
(CLOSED) Rv0657c - small protein from Mycobacterium tuberculosis H37Rv	08/23/11	08/31/14	rws	61
Nanog Transcription Factor	02/11/15	12/31/18	michaeled314	61
test	05/24/11	12/31/19	gurch	65
(CLOSED) 'for everyone	12/04/10	01/09/11	anthunk	67
(CLOSED) A Freestyle Design 40 Open to all	08/14/11	08/31/12	itskimo	68
(CLOSED) BIG CASP9 contest	08/23/11	02/01/12	wudoo	68
(CLOSED) GeneEngineering	05/16/17	06/15/17	chingsong	68
(CLOSED) A Freestyle Design 80 Open to all	08/14/11	09/30/12	itskimo	69
(CLOSED) 80 and everyone	05/15/12	12/31/12	Alakazam Einstein	73
(CLOSED) One last CASP9 Target!	08/25/10	09/28/10	beta_helix	74
(CLOSED) Design Space	06/15/12	06/21/14	drummerdude204	80
(CLOSED) Rv0500B - small protein from Mycobacterium tuberculosis H37Rv	08/24/11	08/10/14	rws	92
(CLOSED) Biology-NanogContest	02/03/12	02/29/12	Seth Cooper	99
(CLOSED) Lastest contest against the cancer	03/30/12	12/31/15	Dj-P	105
(CLOSED) BHS - Nanog Contest	04/24/12	05/12/12	katievh	125
(CLOSED) The Marathon of Foldit - New Chapter	02/01/14	02/28/17	Bruno Kestemont	126
(CLOSED) [DEPRECATED] GTPase Ras long run Anyone can join!	01/28/14	12/31/15	AsDawnBreaks	128
(CLOSED) Everyone Join!	06/28/12	12/24/13	lakeyja900	130
(CLOSED) A GTPase Ras Open To All	08/27/11	09/30/12	itskimo	131
(CLOSED) HIV Protease	01/21/12	03/03/12	recondite7	159
(CLOSED) GTPase Ras Long b [Open to all] [Open discussion]	01/28/14	12/31/17	AsDawnBreaks	169
(CLOSED) Anyone Can Join (freestyle design 80)	07/19/10	07/18/11	spy club	202
Abeta Binder	02/11/15	12/31/18	michaeled314	242
(CLOSED) A Freestyle Design 20 Open to all	08/14/11	08/31/12	itskimo	288
(CLOSED) Fight AIDS	12/09/13	12/31/16	Matthew Krueger	290
(CLOSED) HIV's end	02/13/11	12/31/14	Dj-P	305
(CLOSED) A HIV Protease open to all	08/27/11	09/30/12	itskimo	496
(CLOSED) Let's Cure Cancer Finally	08/18/10	12/31/13	mikedressner	691