Create Contest

All Contests (Only Show Open Contests)

Namesort iconStart DateEnd DateOwnerPlayers
(CLOSED) An 500 segment extended chain that can all be designed.05/04/1605/06/16zduzgun1
(CLOSED) how to make unknownyytw07/29/1307/31/13chinatsu1
(CLOSED) the05/19/1405/20/14HAI-YU CHENG1
(CLOSED) vghubzysd rx07/31/1112/31/13oxyi1
(CLOSED) #awesome03/02/1703/03/17roachfamilymaine1
(CLOSED) 'Brave New World' Class Puzzle04/22/1005/02/10beta_helix25
(CLOSED) 'for everyone12/04/1001/09/11anthunk67
(CLOSED) (Closed) PEP Private Contest II04/12/1204/18/12prolylendopeptidase4
(CLOSED) (Closed) PEP Private Contest III 05/22/1205/31/12prolylendopeptidase3
(CLOSED) 102/26/1402/27/14egilleh1
(CLOSED) 108/19/1008/31/10lipasesucks1
(CLOSED) 107/22/1607/23/16liyixiao1
(CLOSED) 108/04/1608/06/16rossco04071
(CLOSED) 1 week Freestyle 80seg Trimer Design08/30/1309/06/13MurloW2
(CLOSED) 100 amino acids12/09/1212/20/12margo3110
(CLOSED) 100 amino acids12/09/1212/20/12margo3111
(CLOSED) 1112/20/1201/29/13ScottNDean1
(CLOSED) 1208/19/1008/31/10lipasesucks1
(CLOSED) 13-mer toxic peptides05/23/1205/31/12hanhnguyen141
(CLOSED) 16112/26/1512/31/15shunsuketagami1
(CLOSED) 1v Foldit 101/02/1701/18/17kipasceu1
(CLOSED) 1v Foldit-1 F201701/05/1701/18/17kipasceu0
(CLOSED) 1V1 ME UNLESS UR SCARED10/19/1710/21/17I dom1nate0
(CLOSED) 2 weeks, 80 segment design.04/27/1305/11/13MurloW4
(CLOSED) 20 amino acid-- protein08/06/1408/24/14Barbaramoshi0
(CLOSED) 20 seg script test06/05/1012/31/10srssmith921
(CLOSED) 20 segment extended chain that can all be designed.07/27/1608/12/16010100111111
(CLOSED) 200 Residue Freestyle!08/21/1308/21/14meatexplosion44
(CLOSED) 200-residue design puzzle test04/12/1704/18/17LociOiling1
(CLOSED) 2011-11 small Freestyle02/22/1112/31/11Crashguard3034
(CLOSED) 3 day speed folding01/24/1301/27/13jamiexq15
(CLOSED) 3. y biometrix11/30/1511/30/16blomsterman2
(CLOSED) 33mer From Shan et. al.05/23/1206/30/12scooper142
(CLOSED) 3G03/25/1304/30/13rvalensia1
(CLOSED) 3V1A04/23/1705/23/17Bruno Kestemont9
(CLOSED) 40 aa class test09/27/1212/01/12rsingiser1
(CLOSED) 40 freestyle12/09/1312/05/16DashaDv1
(CLOSED) 40 Seg Design Contest04/15/1004/20/10TheGUmmer3
(CLOSED) 40 segment07/16/1007/18/10icreatemac0
(CLOSED) 40 Segment Chain04/22/1204/30/14michaeled3141
(CLOSED) 40 segment Freestyle Design. 2 weeks. 03/22/1304/06/13MurloW3
(CLOSED) 40-204/09/1404/16/14test_account12
(CLOSED) 40-304/09/1404/16/14test_account12
(CLOSED) 43008/03/1108/04/11laurabee1
(CLOSED) 46 Kris07/31/1508/07/15kristoferkeiser0
(CLOSED) 500 for intermediate and beginning players04/15/1404/29/14Andres186000@gmail.com1
(CLOSED) 500 residue freestyle!08/16/1208/20/14meatexplosion3
(CLOSED) 56564564606/11/1006/12/10yjh0
(CLOSED) 576i05/21/1112/31/14oxyi1
(CLOSED) 59 chain protein06/12/1306/30/13ctdevlin1
(CLOSED) 5cDraw Gutstopen04/22/1304/27/13ManVsYard1
(CLOSED) 70204/01/1406/29/14csqu0011
(CLOSED) 70204/01/1406/01/14csqu0011
(CLOSED) 80 and everyone05/15/1212/31/12Alakazam Einstein73
(CLOSED) 80 segment freestyle design. 1 month. 01/29/1302/28/13MurloW10
(CLOSED) 80 Segments Each11/24/1412/23/14ElliottB11
(CLOSED) 80-204/09/1404/16/14test_account11
(CLOSED) 80-304/09/1404/16/14test_account11
(CLOSED) 80segment07/12/1007/31/10asianboy261
(CLOSED) :P Fold it07/25/1408/09/14I-Love-Computers1
(CLOSED) >R0023 SP18154A, Streptococcus pneumoniae, 100 residues12/09/1212/25/12margo3111
(CLOSED) >R0023 SP18154A, Streptococcus pneumoniae, 100 residues MRAQSFFLTFSFIRSKIKLALNKGVLNMIEITYIDASKNERTVTFESYEDFERSQQACLI GVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN 12/02/1212/10/12margo3111
(CLOSED) ??12/20/1001/01/11reedbc1
(CLOSED) a07/11/1007/25/10asianboy261
(CLOSED) a11/27/1112/19/11JimmyFraktal1
(CLOSED) a04/06/1504/14/15jinxed1
(CLOSED) A Battle in Design03/14/1303/14/14TheEnderCavalier0
(CLOSED) A Computer Tester12/09/1112/08/12mat7472
(CLOSED) A Freestyle Design 20 Open to all08/14/1108/31/12itskimo288
(CLOSED) A Freestyle Design 40 Open to all08/14/1108/31/12itskimo68
(CLOSED) A Freestyle Design 80 Open to all08/14/1109/30/12itskimo69
(CLOSED) A GTPase Ras Open To All08/27/1109/30/12itskimo131
(CLOSED) A HIV Protease open to all 08/27/1109/30/12itskimo496
(CLOSED) A london Olympic contest!08/05/1208/12/12junh8214
(CLOSED) a test of rich disordered seq03/19/1303/31/13wangxinyu_cn1
(CLOSED) A#128410/22/1411/30/14Liam02891
(CLOSED) a.l07/13/1007/15/10asianboy261
(CLOSED) A4 test07/30/1508/04/15rohtem1
(CLOSED) aaa04/26/1505/15/15mak3e1
(CLOSED) AATG TK Bioteknologi10/04/1010/08/10thomas.holm@gmail.com1
(CLOSED) ABCDEFG HIJK12/21/1301/05/14Spark51
Abeta Binder02/11/1512/31/18michaeled314191
(CLOSED) Abeta Binder Piecewise Design05/30/1406/21/14fankong2
(CLOSED) Abeta contest CampBIOmed07/09/1407/11/14kaurg3
(CLOSED) Abeta protein CampBIOmed07/15/1407/20/14kaurg7
(CLOSED) ABETA PROTEIN COMPETITION07/29/1408/01/14kaurg4
(CLOSED) abeta- binder12/06/1612/08/16tintin13431
(CLOSED) Acad Alignment Puzle07/11/1307/11/14thomasjs2231
(CLOSED) Acida's test09/22/1009/30/10Acida-215
(CLOSED) ACP10/27/1110/12/12mike r0
(CLOSED) ACP10/27/1110/12/12mike r1
(CLOSED) Acyl Hydrolase04/03/1204/04/12MichaelGasse1
(CLOSED) Adam & Tyler07/20/1307/23/13Adamdejesus2
(CLOSED) Adam & Tyler07/20/1307/23/13Adamdejesus1
(CLOSED) Adelphi FHB Design05/02/1305/12/13ligandfinder6
(CLOSED) Adventure12/03/1612/04/16Justine181
(CLOSED) Ael05/20/1206/03/12Aralys1
(CLOSED) AEL02/14/1702/15/17JaeYeong0
(CLOSED) aendgraend tested contests06/09/1006/13/10aendgraend1
(CLOSED) AIDS12/08/1012/31/11colonelpaco1
AIDS ATTACK01/08/1412/31/17Luciana1
(CLOSED) Aids Security09/02/1001/22/11Gaara1
(CLOSED) aj09/23/1109/24/11ilikeike1
(CLOSED) Alabudzki11/06/1012/31/10alabudzki1
(CLOSED) Albert11/13/1211/14/12Albert_tanjaya2
(CLOSED) Align-it08/14/1008/21/10Arbot36020
(CLOSED) Alignment10/02/1012/31/10sielenk1
(CLOSED) Alignment10/02/1012/31/10sielenk0
(CLOSED) Alignment battle12/12/1012/31/10Nikaeo4
(CLOSED) Alignment test07/23/1107/24/11harvardman0
(CLOSED) Alignment tool (join link in desc)10/26/1112/31/11riking7
(CLOSED) Amazing05/13/1405/18/14Botanix0
(CLOSED) AMES #1 experement10/07/1410/31/14foldase5551
(CLOSED) AMES Science fair made me do it10/07/1410/31/14foldase5551
(CLOSED) AMP102/15/1602/17/16grubbybio1
(CLOSED) Amyloid Beta contest - CampBIOmed08/12/1408/14/14kaurg246
(CLOSED) Another Beat Back the Boredom Old Style01/24/1301/26/13auntdeen19
(CLOSED) Another Contest04/17/1004/22/10TheGUmmer2
(CLOSED) AntProtFly03/06/1403/05/15Flagg65a1
(CLOSED) AntProtFly203/06/1403/05/15Flagg65a1
(CLOSED) any one can join too06/26/1109/01/11plh1
(CLOSED) anyone can join (actually)07/05/1112/16/11madpenguin0
(CLOSED) Anyone Can Join (freestyle design 80)07/19/1007/18/11spy club202
(CLOSED) Anyone can join, HIV Protease, OPEN TO ALL01/06/1302/10/13Phillipthegreat34
(CLOSED) AP BIO Extra Credit09/24/1009/25/10jesalomone116
(CLOSED) AP BIO Pd. 310/28/1511/03/15smuheisen10
(CLOSED) AP Bio Puzzle 111/15/1211/18/12APTeach2351
(CLOSED) Aptamers 109/04/1312/31/13Aiursfallen1
(CLOSED) arabic group09/22/1109/22/14ahmed magdy1
(CLOSED) ARSB06/10/1607/29/16szeitler180
(CLOSED) artificial muscle03/25/1203/31/12AkimotoYuki0
(CLOSED) asdfadf07/05/1007/29/10RoboMonkey1
(CLOSED) asf11/27/1111/30/11JimmyFraktal0
(CLOSED) assasa06/10/1006/11/10yjh1
(CLOSED) AT Testing12/22/1012/26/10anthunk1
(CLOSED) AT Testing Too12/22/1012/26/10anthunk1
(CLOSED) Atg1 Protein10/17/1412/31/14Mecklenburger Friese1
(CLOSED) Atoh1 Atonal homolog 107/11/1108/01/11RANimick0
AtuJ1E6-cpGFP10/01/1510/31/18Lemons1
(CLOSED) axin solve02/14/1702/16/17NiPatFeb20171
(CLOSED) AZV 107/28/1408/09/14azvolpe1
(CLOSED) Back to the Future04/18/1705/16/17chingsong43
(CLOSED) Baltyho prirozeni zda se byt smesne male04/28/1604/29/16MMBP2016-HonJi1
(CLOSED) battle royal09/17/1309/19/13delay0
(CLOSED) BattleGrounds....v.5655.8808/31/1008/24/13InsaneGamer14571
(CLOSED) BC 12411/30/1612/06/16roandavila7
(CLOSED) BCH 441 Fold my protein contest12/04/1612/05/16ryanolson411
(CLOSED) BCHS 320109/26/1111/30/11Fotis NKS0
(CLOSED) BCHS 320109/26/1111/30/11Fotis NKS0
(CLOSED) BCHS320102/20/1302/25/13fahdkabani3
(CLOSED) Beat it! 08/17/1208/18/12Quinton8300
(CLOSED) begginer01/10/1201/19/12bobbyjoejr0
(CLOSED) Beginner Alignment Puzzle12/06/1112/31/11kitek314_pl1
(CLOSED) Beginner Alignment puzzle11/04/1011/11/10science.nerd0
(CLOSED) Beginner Alignment Puzzle11/03/1311/30/13Chris1231
(CLOSED) Beginner Alignment Puzzle01/02/1101/01/12maksimlekler1
(CLOSED) Beginner Alignment Puzzle Sup'Biotech07/12/1307/13/13Darksliver3
(CLOSED) Beginner HIV protease08/07/1208/10/12rarkenin1
(CLOSED) Beginner puzzle copy05/31/1005/18/12Krog1
(CLOSED) Beginners game04/11/1104/17/11Zsolesz840
(CLOSED) Beginning Alignment Puzzle02/04/1102/12/11ltchong0
(CLOSED) bend it10/25/1711/05/17Marlfox30
BendBobsPlayItYourWay07/28/1607/28/19bendbob1
(CLOSED) Best Design11/09/1411/30/14David_M12310
(CLOSED) Best holiday design12/21/1412/31/14Skippysk8s8
(CLOSED) best score09/17/1009/21/10Willbee1
(CLOSED) Beta-carotene dioxygenase10/13/1011/05/10mbarnkob0
(CLOSED) BF Mol Dynamics05/22/1505/25/15Ivelina Zaharieva7
(CLOSED) BHS - Nanog Contest 04/24/1205/12/12katievh125
(CLOSED) BiChE Easy puzzle12/08/1012/10/10ejf3c1
(CLOSED) BIG CASP9 contest08/23/1102/01/12wudoo68
(CLOSED) Big Win08/14/1212/31/15alexlan0
(CLOSED) BIIN351_109/04/1309/18/13ash2
(CLOSED) binding motif test02/16/1102/03/12ceventer1
(CLOSED) Bio 152EC02/06/1202/16/12smfuchs1
(CLOSED) Bio chem assignment02/16/1302/15/14sonneys0
(CLOSED) Bio-Tech 2k1710/20/1710/21/17JosephNi9
(CLOSED) Bio15212/13/1201/31/13smfuchs1
(CLOSED) BIo152 EC02/07/1202/16/12smfuchs1
(CLOSED) Bioc 2nd chance (S13)02/28/1303/02/13jcnichols3
(CLOSED) Bioc EC #210/16/1210/17/12jcnichols18
(CLOSED) Bioc EC Fall 201410/28/1411/15/14jcnichols32
(CLOSED) Bioc F12 EC#110/11/1210/15/12jcnichols30
(CLOSED) Bioc S13 2nd chance02/26/1302/28/13jcnichols1
(CLOSED) Bioc WSC03/06/1203/08/12jcnichols27
(CLOSED) Bioc WSC EC03/06/1203/07/12jcnichols1
(CLOSED) Bioc WSC EC03/25/1203/31/12jcnichols27
(CLOSED) BIOC53012/04/1412/12/14bkoep46
(CLOSED) Bioc670_101/22/1102/10/11bkuhlman24
Biochem 1 Extra Credit11/17/1712/15/17ProfCollins1
(CLOSED) Biochem 12411/12/1611/13/16John Carlo dela Cruz0
(CLOSED) Biochem 463 lab 101/24/1701/25/17BWeber1
(CLOSED) biochem assignment02/16/1302/15/14sonneys1
(CLOSED) Biochem-AD1609/23/1610/07/16Yocan1
(CLOSED) BioClass04/11/1204/15/12sarahod231
(CLOSED) biocon07/26/1207/27/12aurabum1
(CLOSED) BioContest01/27/1101/28/11cbehling2
(CLOSED) bioc_301/26/1202/14/12bkuhlman18
(CLOSED) Bioc_670_201/26/1202/10/12bkuhlman1
(CLOSED) bioc_670_design02/01/1202/15/12bkuhlman19
(CLOSED) Bioc_670_Protease01/26/1202/10/12bkuhlman1
(CLOSED) bioinf06/06/1506/10/1523RPE1
(CLOSED) bioinf0106/06/1506/10/1523RPE1
(CLOSED) bioinf0206/06/1506/10/1523RPE0
(CLOSED) Bioinfor Kaset09/19/1009/27/10kiattawee17
(CLOSED) bioinformatic task for exam12/09/1212/20/12margo3110
(CLOSED) bioinformatic task for exam12/09/1212/20/12margo3110
(CLOSED) bioinformatic task for exam12/09/1212/20/12margo3111
(CLOSED) Biokemi contest03/05/1303/06/13MagnusA1
(CLOSED) Biol. 312 project03/10/1404/29/14Claire_Rinehart1
(CLOSED) BIOL1300/2300 Abeta binder12/12/1612/31/16biol1300_nick20
(CLOSED) BIOL1300/2300 Frizzled12/12/1612/31/16biol1300_nick21
(CLOSED) BIOL1300/2300-2016 contest12/09/1612/31/16nfawzi1
(CLOSED) biol200-3-23-1104/04/1104/09/11gabhsa12
(CLOSED) BIOL225 201401/16/1401/22/14Kimbostu9
(CLOSED) Biology-NanogContest02/03/1202/29/12Seth Cooper99
(CLOSED) Biophysical chemistry workshop - University of Edinburgh02/08/1604/25/16jmichel8012
(CLOSED) Biophysical chemistry workshop University of Edinburgh Test12/19/1412/03/15jmichel8016
(CLOSED) Biostructure Contest05/07/1405/08/14Komsomolez7
(CLOSED) Biotech WFB 103/28/1304/09/13KBrown2
(CLOSED) Biotech WFB HIV03/28/1304/09/13KBrown0
(CLOSED) Biotek Esp 11/04/1411/11/14Henriksk1
(CLOSED) biyokimya_2016_110/19/1610/23/16biyokimya_2016_ismailhoca0
(CLOSED) biyokimya_2016_1.hafta10/19/1610/23/16biyokimya_2016_ismailhoca1
(CLOSED) bjarke join mig10/04/1010/05/10aske20102
(CLOSED) blabla03/17/1203/24/12ccilia1
(CLOSED) Black box4202/09/1102/11/11DaVinci211
(CLOSED) Black Nest of doom11/23/1212/31/12mattymoe0
(CLOSED) Black Nest of doom11/23/1212/31/12mattymoe1
(CLOSED) Black Nest of Doom11/23/1212/31/12mattymoe2
(CLOSED) Blank01/04/1112/31/11kevinjh1
(CLOSED) BLARG12/20/1112/21/11Chappers0
(CLOSED) BLARG12/20/1112/21/11Chappers2
(CLOSED) Blarghs contest04/30/1212/31/12blargh1231
Block 1111/16/1711/26/17drigginar0
(CLOSED) block II test03/03/1503/04/15boltax1
(CLOSED) BMI 206 test contest - protease10/12/1110/13/11amelie.stein1
(CLOSED) BMI 206 test contest - Ras10/12/1110/14/11amelie.stein1
(CLOSED) bonebreake09/09/1009/17/10baeda1
(CLOSED) BP's 61109/10/1009/11/10Bletchley Park1
(CLOSED) Breakfast of Champions11/04/1611/10/16bowman13341
(CLOSED) bugster03/05/1104/30/11alex20111
(CLOSED) Butt04/24/1404/25/14dlaplaca1
(CLOSED) bZIP08/28/1409/18/14sven11031
(CLOSED) C21ECL02/21/1202/25/12lijiahua19841
(CLOSED) C21ECL-102/21/1202/24/12lijiahua19841
(CLOSED) C4lab-Friendly Contest11/04/1411/23/14yi-an Tung7
(CLOSED) Calzolai09/01/1011/08/10iRob0
(CLOSED) Cameron04/03/1204/04/12Cameron Baxendale0
(CLOSED) Cameron04/03/1204/04/12Cameron Baxendale1
(CLOSED) Camp BIOmed 2015 Week 708/17/1508/21/15apklock7
(CLOSED) Camp BIOmed 2015 Week107/06/1507/10/15apklock5
(CLOSED) Camp BIOmed 2015 Week207/13/1507/17/15apklock5
(CLOSED) Camp BIOmed NANOG contest08/11/1408/13/14kaurg246
(CLOSED) Camp BIOmed week 407/27/1507/31/15apklock6
(CLOSED) Can you foldit?01/03/1204/20/12S-Man0
(CLOSED) Can you win?01/06/1201/07/12thekidsglenn71
(CLOSED) cancer help12/06/1212/31/13jordansapp12
(CLOSED) Cancer Puzzle12/11/1112/25/11EzraThexton1
(CLOSED) Cancer Puzzle10/09/1210/11/12beta_helix1
(CLOSED) Cancer Treatment Contest03/24/1204/24/12DaVinci211
(CLOSED) carlos01/18/1401/19/14phillida1
(CLOSED) carlos01/10/1401/11/14bharani942
(CLOSED) CASP 9: Nycticorax nycticorax's mystery.01/01/1101/15/11Dj-P14
(CLOSED) CASP Training02/18/1204/30/12nealk1
(CLOSED) casp training10/20/1110/31/11vk19821
(CLOSED) CASP training puzzle01/02/1101/01/12maksimlekler1
(CLOSED) CASP9 611 residue05/29/1006/15/10Mark-4
(CLOSED) CASP9 targed Design test, all welcome03/01/1107/01/11tyler09111
(CLOSED) CASP9 Target 61110/24/1011/30/10cd111
(CLOSED) CASP9 Target 611 residue protein01/02/1101/01/12maksimlekler1
(CLOSED) CASP9 Target 611 residue protein06/18/1206/18/13meatexplosion2
(CLOSED) CASP9 target Design? 01/02/1101/01/12maksimlekler1
(CLOSED) CASPtraining06/10/1306/30/13Linux_Penguin0
(CLOSED) CC01/05/1201/07/12obson0
(CLOSED) CD44 protein08/14/1008/24/10mikedressner1
(CLOSED) Cell Bio08/22/1708/24/17Dr.Chi1
(CLOSED) cenpH05/07/1508/07/15josephab1
(CLOSED) CH 410 Puzzle 111/30/1612/13/16ProfCollins15
(CLOSED) Chains!08/03/1709/02/17Mao Mao1
(CLOSED) chase10/28/1510/29/15ChaseLehr12341
(CLOSED) CHE 8592 Greek Key Challenge02/09/1702/16/17jakelmer15
(CLOSED) Check05/12/1705/14/17ProfCollins1
(CLOSED) Check Cartesian Bug05/11/1506/30/15brgreening1
(CLOSED) Chem 1307 Spring 2011 Contest03/09/1103/31/11brian.parker13
(CLOSED) CHEM 1460 Puzzle02/04/1102/12/11ltchong1
(CLOSED) CHEM 1460 Puzzle 202/04/1102/11/11ltchong1
(CLOSED) Chem 2225 Spring 2011 Contest03/09/1103/31/11brian.parker7
(CLOSED) Chem 365? 04/02/1704/30/17koehlr60chem3651
(CLOSED) Chem 431 contest08/24/1109/19/11laurabee28
(CLOSED) Chem220810/02/1510/03/15u55863002
(CLOSED) chemchem11102/01/1202/02/12nlite5101
(CLOSED) Chicken Noodle Soup02/17/1306/22/13mattymoe1
(CLOSED) clamp test03/30/1203/31/12hilaryar1
(CLOSED) CLASS CONTEST02/29/1603/31/16Herojohn170
(CLOSED) Clayton Biochemistry Fall 1209/30/1212/01/12rsingiser17
(CLOSED) Clayton Biochemistry Spring 1302/25/1305/05/13rsingiser25
(CLOSED) Clayton Biochemistry Spring 201402/24/1405/01/14rsingiser11
(CLOSED) Clayton Biochemistry Summer 1307/03/1307/24/13rsingiser15
(CLOSED) CLEAN ME!!!!!!!!!!!!!!!!!02/17/1202/18/12Bjamin1
(CLOSED) Client Tests12/04/1312/31/16Matthew Krueger28
(CLOSED) ClpB10/09/1110/28/12kevinjh1
(CLOSED) Coiled Helices03/30/1504/04/15Batz1
(CLOSED) Collins CH 41002/01/1705/10/17ProfCollins11
(CLOSED) Come and Play10/31/1310/22/16roxyroxy0
(CLOSED) Come at me Bro01/08/1501/12/15GentlestElm290
(CLOSED) Common Immunogenic Substrate (Fragment)05/23/1206/30/12scooper143
(CLOSED) Compbio08/22/1108/23/11hahnbeom5
(CLOSED) Compbio208/22/1108/23/11hahnbeom5
(CLOSED) Compbio308/22/1108/23/11hahnbeom5
(CLOSED) Compbio408/22/1108/23/11hahnbeom5
(CLOSED) contest08/01/1708/31/17folditguy1230983
(CLOSED) Contest 10/25/1310/27/13DDarling2
(CLOSED) contest09/27/1112/25/11meganium2140
(CLOSED) contest09/27/1112/25/11meganium2140
(CLOSED) Contest04/14/1604/15/16mxwly3
(CLOSED) Contest03/16/1303/31/13dallinac0
(CLOSED) Contest03/17/1303/18/13CardsOverCoins1
(CLOSED) contest04/22/1204/24/12yesir2
(CLOSED) contest06/26/1107/13/11madpenguin2
(CLOSED) contest03/19/1105/22/11protein1231
(CLOSED) Contest07/30/1207/31/12Nicbudd770
(CLOSED) conTest12/04/1412/12/14jflat061
(CLOSED) Contest #105/30/1505/30/16pizpot2
(CLOSED) contest de foldit05/15/1205/18/12Alakazam Einstein2
(CLOSED) Contest name03/03/1603/04/16Kristian Rodman0
(CLOSED) Contest name goes here?08/02/1008/05/10oakwhiz1
(CLOSED) Contest Template Test 12/21/1512/31/15010100111111
(CLOSED) Contest Template Test 01/02/1101/01/12maksimlekler1
(CLOSED) Contest Template Test 05/04/1605/06/16zduzgun1
(CLOSED) ConTEST105/30/1405/31/14NickyCGS1
(CLOSED) ConTEST1005/30/1405/31/14NickyCGS1
(CLOSED) Contest10000G109/14/1010/01/10crispy fry1
(CLOSED) ConTEST1105/30/1405/31/14NickyCGS1
(CLOSED) ConTEST1205/30/1405/31/14NickyCGS1
(CLOSED) ConTEST1305/30/1405/31/14NickyCGS1
(CLOSED) ConTEST1405/30/1405/31/14NickyCGS1
(CLOSED) ConTEST1505/30/1405/31/14NickyCGS1
(CLOSED) ConTEST1605/30/1405/31/14NickyCGS1
(CLOSED) ConTEST1705/30/1405/31/14NickyCGS1
(CLOSED) ConTEST1805/30/1405/31/14NickyCGS1
(CLOSED) ConTEST1905/30/1405/31/14NickyCGS1
(CLOSED) ConTEST205/30/1405/31/14NickyCGS1
(CLOSED) conTest212/04/1412/12/14jflat061
(CLOSED) ConTEST2005/30/1405/31/14NickyCGS1
(CLOSED) ConTEST2105/30/1405/31/14NickyCGS1
(CLOSED) ConTEST305/30/1405/31/14NickyCGS1
(CLOSED) ConTEST405/30/1405/31/14NickyCGS1
(CLOSED) ConTEST505/30/1405/31/14NickyCGS1
(CLOSED) ConTEST605/30/1405/31/14NickyCGS1
(CLOSED) ConTEST705/30/1405/31/14NickyCGS1
(CLOSED) ConTEST805/30/1405/31/14NickyCGS1
(CLOSED) ConTEST905/30/1405/31/14NickyCGS1
(CLOSED) coolkids2 contest07/06/1207/07/12meelock1
(CLOSED) coolkids2 contest07/06/1207/07/12meelock0
(CLOSED) course work test11/21/1412/31/14chingsong1
(CLOSED) coursework11/20/1412/31/14chingsong27
(CLOSED) CRAC01/31/1202/23/12testdudetest1
(CLOSED) Crashguard303 Script test06/07/1006/14/10Crashguard3033
(CLOSED) CRAZY03/12/1103/17/11alex20111
(CLOSED) Create-a-Protein I01/04/1401/11/14PennyfromHeaven1
(CLOSED) CURE CANCER win 09/24/1109/25/12Ross31
(CLOSED) Curing_Mad_Diseases_Bro07/17/1309/01/13Cyren_Guerrero1
(CLOSED) Custom 50008/07/1709/06/17khendarg1
(CLOSED) Cux1 p110 Cleavage Domain, 440-75308/12/1408/19/14antoine7771
(CLOSED) cyrusi's challange02/17/1201/01/15cyrusi0
(CLOSED) D02/17/1402/24/14MurloW1
(CLOSED) d o08/23/1208/23/15Joanna Staite0
(CLOSED) D&A Mess04/28/1507/12/15ChrisScientist0
(CLOSED) Daddy's11/30/1012/25/10TheDaddyTired0
(CLOSED) dan shit 10/05/1310/06/13nosleevesforlife0
(CLOSED) Dana_Nicolo04/17/1204/18/12dananumber133
(CLOSED) Dave's challenge of despair02/23/1702/24/17bsdn0
(CLOSED) DAYDER VIRTUALIZATION10/30/1310/20/14Roman Rozin0
(CLOSED) DcmB04/18/1207/13/12shadowwalk0
(CLOSED) De Novo Folding of Auts203/24/1406/24/14ACastanza1
(CLOSED) De-Extinction!07/10/1307/31/13gordon_wade0
(CLOSED) Debugger08/05/1308/11/13Tadasu1
(CLOSED) Degradation of Wood! Lets understand methane and CO2 production!01/21/1209/30/12losWEEDos1
(CLOSED) DENE04/30/1605/01/16zduzgun1
(CLOSED) deneme_110/19/1610/20/16ismailhakkiakgun1
(CLOSED) Dengue Virus NS3 protease domain09/26/1110/31/11Neffets1
(CLOSED) design11/22/1212/31/13smart guy0
(CLOSED) Design 20009/13/1509/30/15TheFlagellum0
(CLOSED) Design 4011/17/1212/17/12clptrsn1
(CLOSED) Design a protein11/18/1012/18/10svenskhan1
(CLOSED) design DNA?04/29/1404/30/16kibakabul1
(CLOSED) Design it06/15/1206/21/14DustWitch1
(CLOSED) Design Space06/15/1206/21/14drummerdude20480
(CLOSED) Design test11/01/1311/30/13wisky1
(CLOSED) design test08/19/1308/21/13bkoep1
(CLOSED) design test11/27/1411/30/15ipcfg1
(CLOSED) design your own protein02/13/1202/14/14mberna001
(CLOSED) Design_test12/03/1412/04/14bkoep2
(CLOSED) dhtrjkg vbuibmjjmknv n bogf bjh mknkn05/18/1105/19/14oxyi1
(CLOSED) dhtrjkg vbuibmjjmknv n bogf bjh mknkn05/18/1105/19/14oxyi1
(CLOSED) dhtrjkg vbuibmjjmknv n bogf bjh mknknb05/18/1105/19/11oxyi1
(CLOSED) di trimmer ligand version12/31/1505/01/16ChrisScientist1
(CLOSED) dimer a-helix coiled-coil 11/29/1412/05/14r.gore1
(CLOSED) dimer test12/09/1312/15/16syoifczeri1
(CLOSED) Dino contest05/14/1405/15/14isabelfer2
(CLOSED) DIY Protein (A Big One)12/11/1512/31/15Atombryan1
(CLOSED) Dj-P's duel puzzle02/17/1102/18/11Dj-P1
(CLOSED) Dog tests himself11/07/1111/08/11est000dog1
(CLOSED) DONG1 protein10/20/1711/11/17cxlpku1
(CLOSED) dont worry03/24/1203/29/12billyhuegel0
(CLOSED) DR.B JWU BIOCHEM12/19/1202/10/13drmbudziszek0
(CLOSED) DR.B JWU BIOCHEM Contest-HIV protease01/08/1302/17/13drmbudziszek7
(CLOSED) DrCBDmon06/15/1406/30/14angenentmari1
(CLOSED) drim03/05/1403/06/14emulhall0
(CLOSED) Drosophila Melanogaster nmd protein AAA superfamily02/09/1302/08/14jjwinkle47401
(CLOSED) DSSP algorithm vs NR data base05/29/1206/29/12BitSpawn6
(CLOSED) Dubons Class Contest09/08/1009/10/10dubon12
(CLOSED) Duq Test09/10/1509/11/15pink_cupcakes1
(CLOSED) Duquesne PJAS 109/25/1509/27/15pink_cupcakes9
(CLOSED) Duquesne PJAS 209/25/1509/27/15pink_cupcakes1
(CLOSED) Duquesne PJAS 309/25/1509/27/15pink_cupcakes1
(CLOSED) DuquesnePJAS109/23/1609/25/16EmilyB6
(CLOSED) DuquesnePJAS209/23/1609/25/16EmilyB6
(CLOSED) DuquesnePJAS309/23/1609/25/16EmilyB6
(CLOSED) dyfhyh yghdrh03/11/1503/15/15minecraft4ever41
(CLOSED) e235wef07/07/1307/23/16phallicies1
(CLOSED) easron11/16/1511/17/15EastonSickels12342
(CLOSED) easy10/09/1310/31/16alex900
(CLOSED) easy10/09/1312/31/16alex901
(CLOSED) Easy Contest12/12/1212/30/12haywick0
(CLOSED) Easy DIY Protein (For more precision then the other one)12/11/1512/31/15Atombryan2
(CLOSED) Easy first alignment05/09/1105/31/11serico71
(CLOSED) easy!!!! :o)10/01/1012/31/13yomama0
(CLOSED) EC Fall1510/30/1511/15/15jcnichols1
(CLOSED) EC Fall1510/29/1511/15/15jcnichols14
(CLOSED) Educurious Frizzled Design Puzzle Contest! 02/10/1303/31/13katievh51
(CLOSED) efeli10/11/1110/12/11chatask1
(CLOSED) EL3 #203/01/1305/03/13Wilm0
(CLOSED) ELAV4_48_11809/28/1309/01/14Panoramix1
(CLOSED) Elijahs contest03/08/1303/31/13ilikediamonds2
(CLOSED) ella introduction09/28/1310/28/13manasa0
(CLOSED) Entamoeba insertion domain10/06/1210/12/13lucnoken1
(CLOSED) erero7 challenge02/08/1202/29/12erero70
(CLOSED) erero7 challenge02/08/1202/29/12erero70
(CLOSED) erero7 challenge02/08/1202/29/12erero70
(CLOSED) erero7 challenge02/08/1202/29/12erero71
(CLOSED) Eric's Test11/15/1611/17/16ebrenner141
erj02/12/1712/31/20ScratchKid1
(CLOSED) ERN-Transmembran04/29/1604/30/16zduzgun1
(CLOSED) Erv46 Kris07/31/1508/07/15kristoferkeiser1
(CLOSED) etrg03/26/1112/31/14oxyi0
(CLOSED) etrg03/26/1112/31/14oxyi0
(CLOSED) etrg03/26/1112/31/14oxyi0
(CLOSED) evaesion12/28/1212/31/12Evaesion0
(CLOSED) Even simpler recipe tester05/31/1006/30/10Datstandin1
(CLOSED) Everyone can join12/03/1201/16/13junikl21
(CLOSED) Everyone Join!06/28/1212/24/13lakeyja900130
(CLOSED) Exam 2 EC Spring 201503/27/1504/05/15jcnichols14
(CLOSED) extended_design_tj08/02/1208/05/12TJBrunette1
(CLOSED) Extra credit for exam10/23/1310/31/13jcnichols37
(CLOSED) Extracellular peptide10/18/1710/25/17danielofs1
(CLOSED) F20 for testing12/24/1002/28/11Rav3n_pl8
(CLOSED) Facile for Italian :)09/24/1110/24/11Vaio1
(CLOSED) fahdkabani02/20/1302/21/13fahdkabani2
(CLOSED) Family and Friends05/13/1305/07/16LunarEclipse1
(CLOSED) FANTASY01/09/1201/10/12hu74go1
(CLOSED) Fastest person12/13/1212/22/12ponies_rock1
(CLOSED) fbdfnbdgn05/23/1112/31/14oxyi1
(CLOSED) feqf01/21/1301/17/15jinguluninja1
(CLOSED) ferer gerge01/27/1301/13/16jinguluninja1
(CLOSED) Fight AIDS12/09/1312/31/16Matthew Krueger290
(CLOSED) Fight Liver Cancer06/12/1412/31/14retroneo1
(CLOSED) figure it out08/14/1408/18/14crush21121
(CLOSED) Final Project08/04/1508/31/15megskene1
(CLOSED) find the various aminos07/06/1012/31/10smith92clone2
(CLOSED) fire and rain11/20/1212/22/12mattymoe1
(CLOSED) fire and rain11/20/1212/22/12mattymoe1
(CLOSED) first02/20/1112/31/11jojotastic7771
(CLOSED) first02/25/1112/31/11alex20111
(CLOSED) first contest10/20/1110/21/11Robinso1
(CLOSED) First molecule04/12/1304/13/13gsandoval1
(CLOSED) First puzzle11/29/1412/03/14r.gore1
(CLOSED) first time03/24/1203/25/12billyhuegel1
(CLOSED) FirstTry10/15/1410/17/14Waverka.102
(CLOSED) Flu Puzzle10/09/1210/11/12beta_helix3
(CLOSED) Flu Puzzle Competition10/09/1210/11/12beta_helix28
(CLOSED) Flute lets go son09/30/1410/01/14FluteJasonKarakaedos3
(CLOSED) Foamy Virus Gag protein04/10/1204/17/12blutjoghurt1
(CLOSED) FOLD Championship12/23/1012/31/10Dj-P1
(CLOSED) Fold It (or else)09/20/1009/26/10Zeff0
(CLOSED) Fold It (or else)09/20/1009/26/10Zeff0
(CLOSED) fold it contest11/29/1211/30/12ylecroy2
(CLOSED) Fold It League Preseason Scrimmage02/06/1502/14/15DGOVIL0
(CLOSED) Fold it!04/19/1606/19/16krzysztofbulenger0
(CLOSED) Fold like the wind (blow me away)12/11/1612/31/16kath26560
(CLOSED) Folding con06/16/1506/16/16zedOFF0
(CLOSED) foldit pro10/08/1410/09/14otterballer1
(CLOSED) Foldit tura pierwsza05/23/1405/25/14Behoston17
(CLOSED) Foldit University Challenge11/05/1011/19/10ilya.makedon47
(CLOSED) FOlditExpo06/06/1306/11/13ReinhardtScience11
(CLOSED) Fomento CS04/19/1604/29/16fomento001
(CLOSED) For my students03/16/1203/23/12GirichMS1
(CLOSED) For Science08/07/1509/30/15HDRH0
(CLOSED) For stud. 203/18/1204/30/12GirichMS1
(CLOSED) For stud. 303/18/1204/30/12GirichMS1
(CLOSED) For students03/18/1204/30/12GirichMS1
(CLOSED) For testing purposes03/19/1303/31/13f00barbob1
(CLOSED) Forf04/10/1704/11/17Leser1
(CLOSED) Free Challenge for University Students11/18/1012/18/10ilya.makedon0
(CLOSED) free style 10112/02/1312/25/13Jaceno9
(CLOSED) free style 50009/20/1010/31/10ethanIc1
(CLOSED) Free test07/29/1308/23/13eatfears1
(CLOSED) Freebuild07/18/1107/20/11e-wok4561
(CLOSED) freebuild207/18/1107/20/11e-wok4561
(CLOSED) Freedom01/07/1201/09/12qbolt5000
(CLOSED) Freedom09/13/1709/14/17LilinC331
(CLOSED) freestyle07/11/1509/30/15felix19980
(CLOSED) Freestyle08/16/1208/30/12Mytherus1
(CLOSED) Freestyle10/08/1210/07/13asdf98
(CLOSED) Freestyle09/21/1109/29/11Stano280
(CLOSED) freestyle 2007/25/1708/22/17PatricioBato1
(CLOSED) freestyle 2002/24/1502/24/16manasa1
(CLOSED) Freestyle 2003/17/1203/20/12upquark1
(CLOSED) Freestyle 4007/25/1708/24/17PatricioBato1
(CLOSED) Freestyle 4007/07/1507/08/15LKluke1
(CLOSED) Freestyle 4003/13/1403/14/14Shpooom1
Freestyle 50006/30/1506/15/18emernic1
(CLOSED) Freestyle 80 for a month06/25/1007/31/10sehskyle1
(CLOSED) Freestyle 80 segment de-novo04/22/1304/27/13wosser11
(CLOSED) Freestyle 80 Trimer11/11/1512/20/16AryehK1
(CLOSED) Freestyle Competition07/19/1107/26/11rattlesnake80
(CLOSED) Freestyle DC04/23/1405/28/14spearandmagichelmet1
(CLOSED) Freestyle Design12/16/1512/25/15010100111111
(CLOSED) Freestyle Design12/24/1112/31/11r4m3nn00dl3s0
(CLOSED) Freestyle Design04/22/1204/30/14michaeled3141
(CLOSED) Freestyle Design (80 segments)01/13/1301/31/14OrigamiMaster1
(CLOSED) Freestyle Design - 20 (ST - Recipe Research Channel)06/18/1106/30/11Seagat20111
(CLOSED) Freestyle Design - 80 (Anthropic Dreams team members)06/17/1106/22/11Seagat20114
(CLOSED) Freestyle Design 100 Sandbox03/06/1403/31/17viosca1
(CLOSED) Freestyle Design 15004/02/1504/10/15spacexplorer1
(CLOSED) Freestyle Design 20 05/09/1605/29/16010100111111
(CLOSED) Freestyle Design 20 12/16/1512/31/15010100111111
Freestyle Design 2001/27/1501/31/18HerobrinesArmy1
(CLOSED) Freestyle design 2010/09/1210/09/14meatexplosion1
(CLOSED) Freestyle Design 2007/12/1307/12/16Sadler1
(CLOSED) Freestyle Design 2002/08/1602/29/16010100111111
Freestyle Design 2003/02/1601/01/30khendarg1
(CLOSED) Freestyle Design 200 01/11/1601/01/17010100111111
(CLOSED) Freestyle Design 4007/28/1508/01/15the wheat thin1
Freestyle Design 4001/27/1501/31/18HerobrinesArmy1
(CLOSED) Freestyle design 4010/09/1210/09/14meatexplosion1
(CLOSED) Freestyle Design 4001/30/1512/31/15Hutty1
(CLOSED) Freestyle Design 4007/12/1307/12/16Sadler1
Freestyle Design 4003/02/1611/23/21khendarg1
(CLOSED) Freestyle Design 40 Contest #103/06/1703/13/17FutureScientist12121
(CLOSED) Freestyle design 40 pc08/17/1409/17/14Serraglio0
(CLOSED) Freestyle Design 40: For Learning LUA06/24/1206/30/15gitwut.lua1
(CLOSED) Freestyle Design 500 01/11/1601/31/16010100111111
(CLOSED) Freestyle Design 500 04/28/1105/31/11Acida-24
(CLOSED) Freestyle Design 50012/09/1012/12/10MHannigan1
(CLOSED) Freestyle Design 50011/21/1211/22/12Daileyc0
(CLOSED) Freestyle Design 50010/16/1111/06/11ofc20001
(CLOSED) Freestyle Design 50004/16/1204/29/12drumpeter18yrs9yrs2
(CLOSED) Freestyle Design 50006/15/1506/22/15pipos11
(CLOSED) Freestyle Design 8005/03/1305/18/13iqbalmahmud1
(CLOSED) Freestyle Design 8010/17/1010/01/11BlueRabit1
Freestyle Design 8009/15/1309/15/20Sadler1
(CLOSED) Freestyle Design 8004/13/1304/20/13JamesLeCornu0
(CLOSED) Freestyle Design 8008/21/1010/31/10Handful1
(CLOSED) Freestyle Design 8003/19/1403/20/14thoyt20121
(CLOSED) Freestyle Design 8001/31/1202/09/12kimdn1
(CLOSED) Freestyle Design 8003/24/1209/30/12ofc20001
(CLOSED) Freestyle Design 80 Contest #203/13/1703/20/17FutureScientist12121
(CLOSED) Freestyle Design a 500 length Protein!12/09/1312/31/16Matthew Krueger43
(CLOSED) Freestyle Design Competition06/20/1106/30/11Dinoclor1
(CLOSED) Freestyle Design this 500 residue protein - Seagat201112/17/1001/14/12Seagat201150
(CLOSED) Freestyle Design Variable Length01/09/1101/01/12ten040319771
(CLOSED) Freestyle Design Variable Length. 2 weeks04/09/1304/24/13MurloW1
(CLOSED) Freestyle Design: Variable Length05/02/1305/10/13ligandfinder1
(CLOSED) Freestyle Design: Variable Length04/28/1105/31/11Acida-21
(CLOSED) Freestyle for all11/01/1012/05/10thosi3
(CLOSED) freestyle fun09/26/1212/31/12saggyballs1
(CLOSED) Freestyle Multi-start 499.912/22/1001/01/11Dj-P1
(CLOSED) Freestyle RRM 04/22/1611/29/16obiwan0
(CLOSED) Freestyle RRM 04/22/1611/29/16obiwan0
(CLOSED) Freestyle Simple08/19/1108/21/14WheelerLovett0
(CLOSED) Freestyle Simple08/19/1108/21/14WheelerLovett1
(CLOSED) Freestyle Symmetric Design: 40 Dimer04/04/1404/11/14test_account10
(CLOSED) Freestyle Symmetric Design: 40 Trimer04/04/1404/11/14test_account10
(CLOSED) Freestyle Symmetric Design: 80 Dimer04/04/1404/11/14test_account10
(CLOSED) Freestyle Symmetric Design: 80 Trimer04/04/1404/11/14test_account10
(CLOSED) Freestyle Symmetric Design: 80 Trimer01/15/1601/31/16010100111111
(CLOSED) freestyle synthetic protein designs06/12/1707/12/17jigs1
(CLOSED) freestyle test10/27/1210/28/12Marek_Berlin1
(CLOSED) Freestyle Variable Length. 1 month. 02/26/1303/25/13MurloW8
(CLOSED) Freestyle VarLength06/08/1406/30/14Bithalbierer1
(CLOSED) Freestyle!!!01/11/1201/12/12adele210
(CLOSED) Freestyle15001/30/1501/30/17queentut161
(CLOSED) FreestyleBKG12/22/1012/31/13aricc1
(CLOSED) Frestyle contest10/04/1710/08/17maximiliancarey1
(CLOSED) frezae07/18/1408/31/14frezae0
(CLOSED) Frizzle12/02/1203/02/13marie_s1
(CLOSED) Frizzled03/21/1303/23/13beta_helix1
(CLOSED) Frizzled Design because we are bored01/24/1301/27/13jamiexq17
(CLOSED) Frizzled Design Contest11/30/1412/06/14ingoneato14
Frizzled Design Puzzle Contest02/11/1512/31/18michaeled31421
(CLOSED) Frizzled Design Puzzle Contest - October PD 10/25/1211/01/12katievh1
(CLOSED) Frizzled test05/16/1405/24/14fankong1
(CLOSED) Frizztest08/20/1308/31/13spmm1
(CLOSED) FTN143812/19/1212/31/13nwabu1ao1
(CLOSED) Fun12/12/1012/31/10bost291
(CLOSED) fun11/21/1312/31/16ninjaeliot1
(CLOSED) FUN! FUN!11/17/1211/30/15alexkarate0
(CLOSED) Funny02/01/1404/06/14Spark61
(CLOSED) G-quadruplex03/14/1503/02/16kapick840
(CLOSED) GCN-4 Bipy10/14/1510/16/15LiamMarshall0
(CLOSED) GeneEngineering05/16/1706/15/17chingsong68
(CLOSED) GFP10/18/1010/30/10Pyrohmstr1
(CLOSED) GFP10/18/1010/30/10Pyrohmstr0
(CLOSED) GFP110/18/1010/30/10Pyrohmstr1
(CLOSED) Giordano's Class09/09/1009/13/10cgiordano0
(CLOSED) Go freestyle!04/15/1204/22/12AsDawnBreaks1
(CLOSED) go with the flow12/23/1212/30/12Npereira1
(CLOSED) Go with the flow 212/23/1212/30/12Npereira1
(CLOSED) god berry02/18/1103/12/11My Cranky Panda1
(CLOSED) Golden Goose01/29/1401/30/14Maverik_Goose0
(CLOSED) good luck03/24/1203/25/12billyhuegel1
(CLOSED) Governors Academy Freestylin'12/02/1112/04/11conorodea1111
(CLOSED) GOVST BIOCHEMISTRY05/07/1212/17/12govstbiochem1
(CLOSED) GPCR Test10/09/1310/03/14alathb1
(CLOSED) Grand master rival challenge01/01/1112/31/11Malzarg0
(CLOSED) Greek Key Challenge01/25/1502/10/15jakelmer12
(CLOSED) Greek Key Test02/11/1503/11/15kirkngrant1
(CLOSED) Greek Key Test Run02/11/1503/11/15kirkngrant0
(CLOSED) Greek Key V2.003/30/1504/15/15jakelmer3
(CLOSED) Group V Biophysics BITSG02/09/1605/16/16SandyVii1
(CLOSED) GTPase06/02/1609/15/16yjguo_100
(CLOSED) GTPase07/11/1008/31/10Jordandk1
(CLOSED) GTPase pas puzzle09/14/1212/31/12SOARcdur1
(CLOSED) GTPase Ras09/23/1110/07/11Miah2
(CLOSED) GTPase Ras06/19/1307/20/13ChinaSESsolve1
(CLOSED) GTPase Ras05/15/1305/31/13Ninty90
(CLOSED) GTPase Ras 09/16/1612/08/16hgenzman211
(CLOSED) GTPase Ras08/18/1008/31/10cyclic31
(CLOSED) GTPase Ras09/10/1109/01/12glenwayguy1
(CLOSED) GTPase Ras10/19/1103/18/12wangyueyun1
(CLOSED) GTPase Ras11/23/1212/28/12ridesisapis0
(CLOSED) GTPase Ras11/25/1112/31/11O Seki To0
(CLOSED) GTPase Ras11/10/1311/10/14MyFines0
(CLOSED) gtpase ras02/09/1302/01/15jjwinkle47401
(CLOSED) GTPase Ras 1.012/23/1012/31/10Dj-P1
(CLOSED) GTPase Ras Fold06/25/1507/01/15BlockheadXX0
GTPase Ras Long b [Open to all] [Open discussion]01/28/1412/31/17AsDawnBreaks161
(CLOSED) GTPase Ras test02/29/1204/30/12oshirikajirimushi18th1
(CLOSED) Guanlin_HUST07/03/1507/03/16Guanlinli1
(CLOSED) H3 Hemagglutinin Flu Design Puzzle02/01/1202/03/12beta_helix4
(CLOSED) hahhaaha cool.11/19/1211/23/12joshlitchman1
(CLOSED) Halobacterium NRC-1 Hypothetical Protein01/08/1105/31/11pramodbhat1
(CLOSED) Halorhodopsin02/18/1202/26/12MnSOD0
(CLOSED) hankg1007/28/1407/29/14hankg101
(CLOSED) HansDampf02/28/1305/03/13Wilm0
Happier09/30/1509/30/18ferricst81
(CLOSED) hard11/13/1012/31/10marshin1
(CLOSED) HbA1 Test03/11/1503/12/15minecraft4ever40
(CLOSED) HBA1 Test03/11/1503/13/15minecraft4ever41
(CLOSED) HBA1 Test203/11/1503/12/15minecraft4ever41
(CLOSED) HBM04/12/1507/26/15ChrisScientist1
(CLOSED) HBV core protein03/14/1303/15/13Tsogo0
(CLOSED) HBV core protein03/14/1303/23/13Tsogo1
Hel05/19/1505/19/19ivalnic1
(CLOSED) helix12/09/1412/31/15ivalnic1
(CLOSED) Helix05/13/1505/15/15dendixon0
(CLOSED) helix test05/18/1505/27/15dendixon1
(CLOSED) Help Cure HIV09/05/1609/30/16Toyo1
(CLOSED) hemoglobin check11/26/1111/30/11Rellis1
(CLOSED) Here we go07/14/1507/18/15Unwise1
(CLOSED) Hexaguin's Freestyle 8001/22/1201/31/12hexaguin1
(CLOSED) hi02/17/1202/29/12cyrusi1
(CLOSED) hi202/18/1203/01/12cyrusi1
(CLOSED) Highest score07/07/1312/25/13dbuske0
(CLOSED) Histone H101/03/1101/31/11Dj-P4
(CLOSED) HIV01/07/1202/11/12fallenspartan1
(CLOSED) Hiv12/07/1412/01/15dbuske4
(CLOSED) HIV09/15/1309/29/13trueplayer0
(CLOSED) HIV12/20/1101/31/12Chappers7
(CLOSED) HIV09/26/1309/24/16ScoobyHusky1
(CLOSED) HIV08/15/1406/30/15Test Lab1
(CLOSED) hiv11/12/1001/16/11marshin1
(CLOSED) HIV12/05/1212/29/12Quxwozing1
(CLOSED) HIV Crash test12/21/1012/31/11Dr Tyrell1
(CLOSED) HIV attack06/05/1106/30/12Overlord131
(CLOSED) HIV challenge10/09/1110/30/11ofc20000
(CLOSED) HIV fight!08/22/1008/31/10Rav3n_pl29
(CLOSED) hiv positive10/03/1310/04/13Mhembrough1
(CLOSED) HIV Protease09/01/1309/28/13Gamerrr1110
(CLOSED) HIV Protease03/05/1203/01/13dbuske1
(CLOSED) HIV protease09/17/1009/18/10skoddet120
(CLOSED) HIV protease01/16/1201/17/12recondite70
(CLOSED) HIV protease01/16/1201/20/12recondite72
(CLOSED) HIV protease03/05/1303/26/13alex8090100
(CLOSED) HIV protease07/09/1207/31/12drumpeter18yrs9yrs0
(CLOSED) hiv protease07/11/1007/17/10asianboy261
(CLOSED) HIV Protease01/21/1203/03/12recondite7159
(CLOSED) HIV PROTEASE01/18/1702/01/17gu140010
(CLOSED) HIV protease10/17/1110/22/11Joshua Algode1
(CLOSED) HIV protease01/02/1101/01/12maksimlekler1
(CLOSED) HIV protease01/25/1201/31/12docfon1
(CLOSED) hiv protease10/19/1110/19/12jerrywhite131
(CLOSED) HIV protease01/09/1112/31/14Alegend451
(CLOSED) HIV protease03/27/1404/04/14Professor West11
(CLOSED) HIV Protease03/16/1606/01/16CureForDiabetes1
(CLOSED) HIV protease - BIOL22501/16/1401/22/14Kimbostu6
(CLOSED) HIV Protease - BIOL22501/22/1501/29/15Siderhurst11
(CLOSED) HIV protease - BIOL22501/28/1602/04/16Siderhurst11
(CLOSED) HIV protease BK06/10/1506/11/15bkoep1
(CLOSED) HIV protease contest12/04/1412/07/14DrewNyeTheScienceGuy0
(CLOSED) HIV protease contest!05/29/1105/31/11chouti1
(CLOSED) HIV Protease Folding05/10/1705/13/17Komsomolez6
(CLOSED) HIV protease new09/29/1110/31/11davidpat1
(CLOSED) HIV protease sandbox05/04/1105/01/14tyler091149
(CLOSED) HIV protease test03/01/1205/01/12oshirikajirimushi18th1
(CLOSED) HIV solvers12/31/1504/01/16Sammie1231
(CLOSED) HIV stinks.... yeah yeah05/12/1205/01/14tweak641
(CLOSED) HIV test04/11/1204/13/12SciShowFTW1
(CLOSED) HIV Trouble09/18/1709/30/17LOGOLOZ1
(CLOSED) HiV try08/20/1009/20/10Pyotr1
(CLOSED) HIV's end 02/13/1112/31/14Dj-P305
(CLOSED) hjjjjjjjjjjjjjjjjjj12/20/1112/31/14oxyi1
(CLOSED) hm04/07/1304/09/13MurloW1
(CLOSED) hmm04/07/1304/09/13MurloW1
(CLOSED) hnvfcfhncfh kbkkkh06/15/1112/31/14oxyi1
(CLOSED) Holotoxin02/03/1202/06/12Erik.dover0
(CLOSED) Homology Modeling Course: HIV Protease06/12/1206/15/12obiwan7
(CLOSED) Homology_Praktikum_IBK_SS1106/16/1106/20/11csac19599
(CLOSED) hotu11/12/1011/30/10marshin1
(CLOSED) Human Respiratory Syncytial Virus Attachment Protein (RSV G)04/12/1207/31/12MiCu1
(CLOSED) Hypotethical Protein ATU022510/21/1410/09/15gorrila131
(CLOSED) i01/27/1701/30/17zduzgun1
(CLOSED) I Dare You!!!01/09/1501/10/15nakul_07020
(CLOSED) i-motif DNA structure08/01/1308/31/13csjonline0
(CLOSED) Ice-structuring protein02/01/1602/29/16Tajuton_potilas21
(CLOSED) Immunoglobulin D Hinge H108/06/1408/17/14frogzorz0
indi 500 segment race05/17/1412/31/17jeshprabakaran1
(CLOSED) indoor soccer shoes adidas f5007/24/1307/26/13Clarisonic1230
(CLOSED) Insulin07/14/1507/18/15Unwise0
(CLOSED) intracellular Caspase-Modulating Chimeric Antigen Receptor07/17/1207/17/14starone0
(CLOSED) Investigate Inspect Test08/20/1308/21/13NickyCGS3
(CLOSED) invite only12/04/1512/04/16vkalas1
(CLOSED) IQS protein folding contest 201403/17/1403/31/14xevi.biarnes1
iRFP02/13/1702/13/20amao11
iRFP 202/13/1702/13/20amao11
(CLOSED) ISHMIT DAHAL03/18/1303/19/13USER20131
(CLOSED) ismailhakkiakgun10/19/1610/24/16ismailhakkiakgun1
(CLOSED) IVa211/03/1412/20/14paul.kascak1
(CLOSED) IVa211/14/1411/30/14paul.kascak1
(CLOSED) IVa211/23/1411/07/15paul.kascak1
(CLOSED) j09/30/1110/01/11klixovann0
(CLOSED) jhdfksaufsahkmd02/28/1403/02/14spider8762
(CLOSED) JJJP bmi206 fold11/07/1111/30/11Peter20000
(CLOSED) JJT twincombo11/30/1501/31/16Canadian KId2
(CLOSED) jnkljnklhjnljnljnl12/04/1112/31/11oxyi1
(CLOSED) jnkljnklhjnljnljnl12/04/1112/31/11oxyi0
(CLOSED) Join if u Dare04/26/1304/20/14srgp20125
(CLOSED) jujujujujujujujujujujujujuj ujujujujujujujujujujujujujujujujujujujujujujuju12/24/1112/31/14oxyi1
(CLOSED) Just 4 fun07/12/1207/20/12Josephdud661
(CLOSED) Just a puzzle07/01/1307/31/13wisky1
(CLOSED) just do it10/30/1112/31/11pokemon.guy0
(CLOSED) Just For Begginers04/29/1504/30/15timothyu1201
(CLOSED) Just For Fun01/26/1201/27/12Metadryad1
(CLOSED) Just for test09/06/1209/07/12dyh1
(CLOSED) Just playing around03/13/1203/20/12wdherndon1
(CLOSED) kanya10/14/1010/26/10g53144016731
(CLOSED) Kenny10/26/1201/01/13kennyhill0
(CLOSED) khc head04/13/1104/20/13ceventer0
(CLOSED) khc test10/14/1010/14/11ceventer1
(CLOSED) khfchlk 102/23/1202/24/12Solenopsis invicta1
(CLOSED) killen04/23/1504/24/15woops7
(CLOSED) King of the Class12/10/1512/11/15crostomily6
(CLOSED) kk's contest04/20/1104/30/11kkwizard1011
(CLOSED) Knotfind on12/10/1112/31/11beta_helix6
(CLOSED) Knots05/22/1205/23/12AsDawnBreaks1
(CLOSED) Kumamolisin06/13/1207/31/15drummerdude2041
(CLOSED) l2pmike09/24/1209/25/12OppaProteinStyleZ0
(CLOSED) l2pmike09/24/1209/25/12OppaProteinStyleZ0
(CLOSED) Lab Sequence10/16/1310/01/14Orangeutan1
(CLOSED) Lac repressor05/17/1605/24/16dunawayjacob1
(CLOSED) Laccase01/19/1101/23/11El_Crazy_Xabi1
(CLOSED) Large Protein Test12/14/1012/15/10Gray Thomas1
(CLOSED) LASA Octagon02/07/1302/10/13JosephOleniczak0
(CLOSED) Lastest contest against the cancer03/30/1212/31/15Dj-P105
(CLOSED) laura test08/23/1108/24/11laurabee1
(CLOSED) laura test208/23/1108/24/11laurabee1
(CLOSED) Laurabee's puzzle07/13/1107/14/11laurabee0
(CLOSED) Leishmania donovani Ornithine decarboxylase11/20/1511/25/15mikroplasma2
(CLOSED) Let's Cure Cancer Finally08/18/1012/31/13mikedressner691
(CLOSED) Let's go!!!!04/28/1212/12/12wendy_rupnow0
(CLOSED) Let's go!!!!04/28/1212/12/12wendy_rupnow0
(CLOSED) Let's have fun.07/25/1108/02/11etety331
(CLOSED) Lets have fun01/11/1501/13/15imenm3
(CLOSED) LETSGO08/26/1108/27/11wudoo4
(CLOSED) leukaemia virus chain native matrix02/01/1208/27/12GoshaDole1
(CLOSED) ligamaze12/31/1503/31/16ChrisScientist1
(CLOSED) ligan practice -open to all03/21/1203/31/12Mike Tate3
(CLOSED) Ligand Folding Practice- Open to all05/01/1109/01/11tyler091123
(CLOSED) Ligand Practice05/24/1109/11/11tyler09113
(CLOSED) Ligand Practice12/07/1312/16/13slofgren1
(CLOSED) ligand test02/13/1402/12/15syoifczeri1
lilovip-tests-0208/05/1508/31/18lilovip1
(CLOSED) lilovip0106/22/1407/22/14lilovip1
(CLOSED) linker04/11/1504/30/15463418196@qq.com1
(CLOSED) lms friends12/03/1212/04/12johncb30
(CLOSED) LOL FU 09/30/1610/30/16BroC41
(CLOSED) Long Contest09/20/1001/01/12maquiladora1
(CLOSED) Long links04/21/1204/30/12AsDawnBreaks6
(CLOSED) Loss Cancer08/31/1012/31/10FalconDeOro1
(CLOSED) lost points test case03/26/1412/25/14brgreening1
(CLOSED) lost points test two04/25/1404/25/17brgreening1
(CLOSED) love vs. love02/22/1202/24/12k.love2
(CLOSED) LOX enzyme from human05/21/1312/24/13magnus groes1
(CLOSED) LPDF Contest04/30/1205/03/12maxionwimps1
(CLOSED) LUA test01/05/1101/30/11Dj-P1
(CLOSED) lv.1 03/28/1104/03/11Marco Chan1
(CLOSED) M07/05/1007/31/13RoboMonkey1
(CLOSED) m,jb ghj06/15/1112/31/14oxyi0
(CLOSED) m,jb ghj06/15/1112/31/14oxyi1
(CLOSED) Mad hatter01/17/1301/18/13EmperorSupreme0
(CLOSED) Make a Greek Key01/27/1502/10/15jakelmer0
(CLOSED) Malaria Puzzle10/09/1210/11/12beta_helix3
(CLOSED) manners12/21/1302/28/14Spark51
(CLOSED) Marcus05/17/1205/20/12mdaquino1
(CLOSED) marolidas sandbox11/20/1211/27/12marolidas1
(CLOSED) Mat test03/20/1203/20/13mat7471
(CLOSED) math modeling07/16/1007/29/12themarquis1
MC&SDRocks02/27/1702/24/18SunSalutation2
(CLOSED) McCallie AP Biology09/07/1309/11/13mccallieapbiology0
(CLOSED) me and freinds11/05/1711/07/17Nusayr1
(CLOSED) Mean, lean, crumple machine02/20/1406/22/14mind_hack1
(CLOSED) MedChem1410/16/1410/27/14pedrofong3
(CLOSED) MediumFREE STYLE08/23/1108/31/14WheelerLovett0
(CLOSED) MediumFREE STYLE08/23/1108/31/14WheelerLovett1
(CLOSED) meh10/17/1010/31/10anthunk1
(CLOSED) Membrane receptor12/20/1202/28/13ScottNDean1
(CLOSED) Merry post-christmas12/25/1512/28/15-x-1
(CLOSED) Metallothionein11/05/1211/30/12Phil.Pa1
(CLOSED) MGC - 201701/18/1701/24/17Kimbostu7
(CLOSED) MGC 201401/16/1401/22/14Kimbostu1
(CLOSED) Miami University02/18/1602/21/16dirk411
(CLOSED) Michael04/26/1504/28/16jinxed2
(CLOSED) Michael and Marco10/05/1110/06/11bigbanggd4100
(CLOSED) Michael and Marco10/05/1110/06/11bigbanggd4100
(CLOSED) Michael and Marco10/05/1110/06/11bigbanggd4102
(CLOSED) mine silly01/17/1112/31/11anthunk1
(CLOSED) Miniprotein1L2Y04/23/1705/23/17Bruno Kestemont4
(CLOSED) Miso try 210/14/1410/01/17asmidler1
(CLOSED) Miso: a critical protein for mosquito reproduction10/14/1410/01/16asmidler1
(CLOSED) missing side chains01/24/1402/23/14apoma0
(CLOSED) Moar Freestyle Design. 80 seg, 1 week03/26/1304/02/13MurloW2
(CLOSED) Moe10/21/1510/01/16ivalnic1
(CLOSED) Moloney Murine Leukaemia Virus Matrix Protein 02/14/1205/15/12Ch Garnier29
(CLOSED) Moloney Murine Leukaemia Virus Matrix Protein 02/01/1202/03/12beta_helix4
(CLOSED) Monkeys Rock Ham jhhh hhhhhhhhh12/04/1212/30/12NathanGotSkills230
(CLOSED) Monooxygenase03/10/1204/30/12hansfoldit0
(CLOSED) Montcrest12/20/1101/31/12Chappers3
(CLOSED) Montcrest12/20/1101/31/12Chappers1
(CLOSED) Montcrest for real12/20/1101/31/12Chappers1
(CLOSED) more testing05/04/1112/31/14anthunk1
(CLOSED) more thunk testing03/29/1206/30/12anthunk9
(CLOSED) motor protein tail08/23/1008/23/11ceventer1
(CLOSED) MPI10/31/1311/30/13Mengzzz19
(CLOSED) Mr Faure 1v1 me lmao 100XDDDDDDDDDDD11/14/1711/15/17B0B05
(CLOSED) Mr Ma No. One07/29/1107/29/14mayumiao1
(CLOSED) Mr Ma No.107/27/1107/31/12mayumiao1
(CLOSED) MRMAND12311/09/1111/09/12MR MAN D1
mTOR02/23/1502/23/18kurenan1
(CLOSED) Multi-domain protein04/10/1307/10/13pbartlow1
(CLOSED) Multi-histidine and Glutamate sequence complexed with Mn(II)09/26/1110/10/11masspeana1
(CLOSED) Multi-Start Bacteroides Vulgatus Contest 10/13/1204/13/13Ch Garnier17
(CLOSED) mutate_test02/25/1404/25/14robgee1
(CLOSED) mva1alpha09/22/1009/21/11mvackel1
(CLOSED) My 500 Test01/17/1402/24/14BCAA1
(CLOSED) my bio info assinment version 201/17/1502/01/15c0d3w4rri0r1
(CLOSED) my bioinfo assinment01/17/1502/12/15c0d3w4rri0r1
(CLOSED) My Contest11/04/1611/05/16Benbennett20003
(CLOSED) my contest09/20/1112/20/11Lysergic cure1
(CLOSED) my contest10/01/1610/30/16Carlos Santamaria1
(CLOSED) my contest09/01/1009/02/10marissa1010
(CLOSED) My first contest09/14/1209/30/12SOARcdur1
(CLOSED) My first contest10/26/1110/31/11awesome41321
(CLOSED) My first contest))11/01/1311/07/13krytoy10
(CLOSED) my freestyle trial12/20/1112/27/11Niubilism1
(CLOSED) Myoglobin06/08/1406/15/14Bithalbierer1
(CLOSED) myoglobin01/22/1201/26/12vacmar1
(CLOSED) Myoglobin11/30/1112/23/11Ronald Wichman0
(CLOSED) N-GlnR06/09/1209/30/12weihuachen52111
(CLOSED) nanog07/17/1407/24/14oli-popxD1
(CLOSED) Nanog Homeobox Protein (NANOG)03/07/1203/07/13Ch Garnier34
Nanog Transcription Factor02/11/1512/31/18michaeled31447
(CLOSED) Nanog Transcription factor contest07/29/1407/31/14kaurg3
(CLOSED) Nanog Transcription Factor Contest - CampBIOmed07/15/1407/16/14kaurg10
(CLOSED) NEAR contest09/27/1309/29/13nyla121
(CLOSED) Need structure09/29/1010/10/10canikickit491
(CLOSED) New small test06/17/1007/30/10Crashguard3034
(CLOSED) new test06/03/1406/04/14test_account11
(CLOSED) New_contest11/07/1412/09/14pedrofong0
(CLOSED) New_contest11/07/1412/09/14pedrofong14
(CLOSED) niep10/24/1010/26/10niep03291
(CLOSED) nmd AAA ATPase02/09/1302/08/14jjwinkle47409
(CLOSED) No Peeking - Immediately drag puzzle off screen when beginning. Players should NEVER see the protein. 06/01/1206/30/12phi1646
(CLOSED) No. 4.03/18/1204/30/12GirichMS1
(CLOSED) No. 503/18/1204/30/12GirichMS1
(CLOSED) No. 603/18/1204/30/12GirichMS1
(CLOSED) normal contest02/04/1502/05/15deephama0011
(CLOSED) Oakwood Honors Bio Contest09/17/1509/30/15elightrake1
(CLOSED) Obliged to try that!12/01/1302/28/14Gabs_the_lil_protein1
(CLOSED) ofc2000's tough challenge (open)10/29/1110/31/11ofc20001
(CLOSED) One day challenge11/04/1111/05/11scienceschmoo0
(CLOSED) One day challenge11/04/1111/05/11scienceschmoo1
(CLOSED) One last CASP9 Target!08/25/1009/28/10beta_helix74
(CLOSED) Open 500 Segment design puzzle 09/09/1212/31/15Ryanfav49
(CLOSED) Open Design Test10/18/1310/19/13picklion1
(CLOSED) Open University Challenge11/20/1012/18/10ilya.makedon2
(CLOSED) Other receptor12/20/1212/14/13ScottNDean1
(CLOSED) outer envelope protein 80 [Arabidopsis thaliana]11/12/1501/05/16swimbug20140
(CLOSED) outer envelope protein 80 [Arabidopsis thaliana]11/11/1501/06/16swimbug20141
(CLOSED) owen01/13/1401/20/14owen9o9300
(CLOSED) P1a1b10/22/1010/21/11mvackel1
(CLOSED) P22-N04/23/1304/27/13syoifczeri1
(CLOSED) P22-N^W[Tb]04/23/1304/30/13syoifczeri1
(CLOSED) P9804/23/1504/30/16hphilipp1
(CLOSED) PA1955_Repeat11/10/1112/23/11MadsTS1
(CLOSED) Pace Academy 2014 HIV protease08/21/1312/21/13thattori37
(CLOSED) Pass the Thyme01/09/1102/28/11TheGUmmer1
(CLOSED) PdB2411/05/1002/01/11PdB240
(CLOSED) PdB2411/05/1002/01/11PdB241
(CLOSED) pechi demo03/03/1306/07/13anthunk2
(CLOSED) Pedobacter Beta Barrel12/14/1012/25/10Gray Thomas1
(CLOSED) Penn State Hershey BMS 50410/15/1210/28/12iropson1
(CLOSED) Penn State Hershey BMS 504 Contest 210/15/1210/28/12iropson27
(CLOSED) peptide test05/31/1305/17/14syoifczeri1
(CLOSED) Peptides to design07/26/1501/01/16Brabrax0
(CLOSED) peter and kim02/03/1604/02/16petetrig1
(CLOSED) peter and kim02/03/1606/11/16petetrig1
(CLOSED) PfTLP07/16/1307/16/14BNGSTE0011
(CLOSED) PFV Gag04/17/1207/17/12blutjoghurt1
(CLOSED) PhAlpha1Beta09/12/1009/13/10mvackel1
(CLOSED) PhAlpha1Beta09/12/1009/15/10mvackel1
(CLOSED) Phalpha1beta08/14/1008/15/10mvackel1
(CLOSED) phospholipase A2 from mamushi snake venom01/11/1201/26/12gurimmer0
(CLOSED) PitA07/16/1308/10/13canthony91
(CLOSED) PODXL08/04/1108/26/11machoo1
(CLOSED) Polish Contest11/20/1112/20/11Mojzesz4
(CLOSED) Polite12/21/1304/25/14Spark52
(CLOSED) popopop12/28/1312/31/13swl20131
(CLOSED) Porin02/27/1503/02/15Jonathan511
(CLOSED) Practice Contest12/10/1512/11/15crostomily8
Practice Space--FREESTYLE: VARIABLE LENGTH11/24/1611/21/18Puttering1
Practice Space--SEAL MYOGLOBIN11/24/1611/21/18Puttering1
(CLOSED) PRACTICE TEST 112/08/1512/09/15seantan3
(CLOSED) PRACTICE TEST 212/08/1512/09/15seantan3
(CLOSED) Practice_folding_from_scratch08/22/1612/01/16Miguel.alj3901
(CLOSED) Pregnancy Associated Plasma Protein (PAPP-A)03/12/1108/15/11meschruhms1
(CLOSED) prejudice on HIV06/13/1412/16/14manasa1
(CLOSED) Private Contest10/21/1310/23/13theOMGmonster0
(CLOSED) Private Contest02/27/1502/28/16babacon1
(CLOSED) progesterone reductase10/25/1310/25/14sarahoconnor0
(CLOSED) protein 3AB [Enterovirus C]03/08/1505/08/15orangejayo11
(CLOSED) Protein Contest04/25/1212/31/12Dave Levine0
(CLOSED) protein desgin 06/11/1306/14/13ctdevlin1
Protein Folding with Point mutations07/28/1506/16/18emernic1
(CLOSED) Protein Laboratory12/10/1312/25/13slofgren1
(CLOSED) Protein Stability05/31/1612/31/16Alisa Southerncross0
(CLOSED) protein to test scripts05/22/1012/31/10smith92clone1
(CLOSED) prova01/08/1201/17/12hu74go1
(CLOSED) prueba 1x10/22/1011/11/10rascuacho0
(CLOSED) prueba mioglobina06/30/1306/11/14cmendo1
(CLOSED) Pseudomonas aeruginosa PA406302/28/1603/31/16mutinus1
(CLOSED) Putative Plant Protein10/10/1410/31/14Mecklenburger Friese1
(CLOSED) QQ06/21/1707/20/17416074311
(CLOSED) Quick & Dirty KnotFind12/25/1101/03/12NessunDorma1
(CLOSED) Quinoa Test07/09/1507/31/15dinoboy111
(CLOSED) R301/29/1401/30/14maverickandgoose1
(CLOSED) Raf kinase inhibitor03/07/1403/30/14pongoo1
(CLOSED) raid10/19/1610/20/16TheEnderCavalier1
(CLOSED) raid 210/20/1610/21/16TheEnderCavalier1
(CLOSED) Raid 310/21/1610/22/16TheEnderCavalier0
(CLOSED) Random01/28/1201/31/12dabanks1
(CLOSED) Random Puzzle08/03/1108/04/11Mp09070
(CLOSED) Random Puzzle08/03/1108/04/11Mp09071
(CLOSED) random test10/12/1012/31/10Ryanfav1
(CLOSED) rc01305/09/1205/31/12jlmaccal1
(CLOSED) Real Oakwood Honors Bio Contest09/17/1509/30/15elightrake4
(CLOSED) Recipe tester05/31/1007/01/10Datstandin2
(CLOSED) Red Block 2 | The Foldit Games01/30/1402/07/14xXF4T3D_P4R4D0Xx6
(CLOSED) Reinhardt Demo stuff06/04/1306/18/13ReinhardtScience1
(CLOSED) RevDimer12/04/1412/05/14Tanamura1
(CLOSED) ricg contest05/17/1305/18/13RicGray1
(CLOSED) ricgtest03/18/1303/24/13RicGray0
(CLOSED) Rod10/08/1210/09/12Rodrigo9990
(CLOSED) Rodrigo10/08/1210/16/15Rodrigo9991
(CLOSED) Ronny-test09/22/1709/30/17ronnygeo1
(CLOSED) Rv0500B - small protein from Mycobacterium tuberculosis H37Rv08/24/1108/10/14rws92
(CLOSED) Rv0657c - small protein from Mycobacterium tuberculosis H37Rv08/23/1108/31/14rws61
(CLOSED) SAC Summer 2012 OChem Challenge06/04/1206/10/12brian.parker24
(CLOSED) SaLLIa666 Game01/08/1401/12/14SaLLIa6661
(CLOSED) sample05/08/1205/22/12govstbiochem0
(CLOSED) Sandbox10/10/1110/31/12kevinjh1
(CLOSED) Sandbox09/30/1610/02/16CollBio1
(CLOSED) Sandbox10/05/1310/19/13creteen1
(CLOSED) Sandbox puzzle for CASP905/02/1005/19/10beta_helix22
(CLOSED) Sandbox-4012/01/1012/02/10kevinjh1
(CLOSED) Sandbox102/03/1202/29/12nlite5101
(CLOSED) Sandboxing, private pls07/04/1407/04/15Thardus1
(CLOSED) sang contesy11/30/1312/09/13swl20131
(CLOSED) SarNorA06/12/1207/12/12docsaro1
(CLOSED) SAY HI TO ZACH10/11/1110/31/11za-za220
(CLOSED) SBG02/18/1102/19/11crma3
(CLOSED) Science aids08/09/1308/12/13sience geek2
(CLOSED) Science One Team 10 Project03/20/1704/01/1706SciOne4
(CLOSED) scienceteach test wee06/04/1306/18/13ReinhardtScience1
(CLOSED) ScienceTeacherTresting06/04/1306/18/13ReinhardtScience0
(CLOSED) Script test III08/12/1010/12/10Crashguard3036
(CLOSED) Script Test IV09/21/1001/31/11Crashguard3031
(CLOSED) Script test ligand10/20/1001/31/11Crashguard3034
(CLOSED) Script tester - Design01/01/3005/24/13Krog1
(CLOSED) Script tester 207/04/1007/05/12Krog1
(CLOSED) Script tester 307/04/1007/08/11Krog0
(CLOSED) Script tester 307/04/1007/08/11Krog1
(CLOSED) Script testing11/23/1212/31/15Jean-Bob11
(CLOSED) scritterTest02/15/1302/28/13scritter1
(CLOSED) scritterTest202/15/1302/28/13scritter1
(CLOSED) SEAL MYOGLOBIN 04/28/1105/31/11Acida-21
(CLOSED) seal myoglobin12/01/1012/01/12traywright1
(CLOSED) Seal Myoglobin03/03/1403/09/14PeerPride0
(CLOSED) SEAL MYOGLOBIN10/23/1010/30/10samwitus0
(CLOSED) seal myoglobin01/13/1201/31/12sum1
(CLOSED) seal myoglobin01/13/1201/31/12sum0
(CLOSED) SEAL MYOGLOBIN03/13/1705/11/17srinaldi16561
(CLOSED) SEAL MYOGLOBIN11/23/1101/31/12Ch Garnier14
(CLOSED) SEAL MYOGLOBIN01/02/1101/01/12maksimlekler1
(CLOSED) Seal Myoglobin11/26/1111/29/11Lelivret1
(CLOSED) SEAL MYOGLOBIN05/25/1211/25/12Ch Garnier19
(CLOSED) Second part12/10/1212/24/12Placebo1
(CLOSED) Serine Proline Rich AfCNA05/25/1206/28/12cookie20041
(CLOSED) SERPINB512/19/1112/26/11Niubilism0
(CLOSED) Server models for T0743 Contest10/13/1205/13/13Ch Garnier12
(CLOSED) Seymoue03/16/1503/19/15ChAda20150
(CLOSED) sgner04/07/1604/08/16sgner0
(CLOSED) sgner104/07/1604/08/16sgner1
(CLOSED) sgnerTEST04/07/1604/08/16sgner1
(CLOSED) SH3PX111/25/1402/28/15Patrick11160
(CLOSED) SH3PX111/25/1402/28/15Patrick11160
(CLOSED) SH3PX111/25/1402/28/15Patrick11161
(CLOSED) SH3PX111/25/1402/28/15Patrick11160
(CLOSED) SH3PX111/25/1402/28/15Patrick11160
(CLOSED) Sheet Banding Trick03/21/1104/30/11itskimo0
(CLOSED) SHELL08/09/1208/08/13chingsong0
(CLOSED) Short Blank10/10/1110/31/12kevinjh1
(CLOSED) show your protein10/10/1410/30/14Hydromaker1070
(CLOSED) SHS11/20/1511/21/15fanerdbcshs4
(CLOSED) silk protein09/22/1309/13/14danielgcc1
(CLOSED) Sim-based Lifecycle Engineering02/29/1203/31/12mxynidis1
(CLOSED) Simpler recipe tester05/31/1006/30/10Datstandin2
SK III!12/07/1612/31/19ScratchKid1
(CLOSED) SK IV12/29/1612/31/15ScratchKid0
(CLOSED) SK SK09/01/1312/31/16ScratchKid1
(CLOSED) SK SK09/01/1312/31/16ScratchKid2
SK SK II12/04/1612/31/19ScratchKid1
SK V12/29/1612/31/19ScratchKid1
SK VI12/29/1612/31/19ScratchKid1
(CLOSED) SK VII12/29/1612/31/92ScratchKid1
SK VII02/02/1712/31/20ScratchKid1
(CLOSED) SKHJGFDRSKL11/12/1011/30/10marshin1
(CLOSED) slither09/16/1012/31/13missb0
(CLOSED) Small Dimer08/22/1308/29/13spdenne1
(CLOSED) Small Hepatitis B Surface Antigen (HBsAg)05/07/1305/07/14bigben4461
(CLOSED) Small partial Tspan peptide12/21/1112/31/11rwarn1
(CLOSED) Small Peptides09/27/1411/30/14Batz1
(CLOSED) Small test 20 segment12/05/1412/01/15aninweton1
(CLOSED) Small test protein09/17/1312/31/13wudoo1
(CLOSED) Small test protein 209/17/1312/31/13wudoo1
(CLOSED) small test variable length12/05/1412/05/15aninweton1
(CLOSED) SMIM1 03/24/1303/31/13gestur3
(CLOSED) Solve for Treatment08/30/1309/10/13PirateX122
(CLOSED) Some Test Contest01/26/1202/05/12Biology-EtcManager2
(CLOSED) Sorry, This is test06/27/1306/28/13myputer1
(CLOSED) Sparky01/09/1403/09/14Spark61
(CLOSED) Spider silk design09/01/1312/31/16Jirachi1
(CLOSED) Spielwiese - Freestyle Design (Variable Length)12/25/1103/31/12Bithalbierer4
(CLOSED) Spielwiese - HIV Protease12/25/1103/31/12Bithalbierer7
(CLOSED) Spielwiese Freestyle Design 4012/08/1212/31/13Bithalbierer1
(CLOSED) Start of Sumer HIV06/19/1306/26/13nerdysib1
STD10/01/1512/31/18Smellis0
(CLOSED) Stefano Fuschetto09/30/1407/22/16Stefano Fuschetto0
(CLOSED) Stop The HIV Protease12/28/1212/31/12Evaesion1
(CLOSED) Streptococcus pneumoniae12/02/1212/31/12Placebo1
(CLOSED) Streptococcus pneumoniae 8012/02/1212/31/12Placebo1
(CLOSED) stress responsive protein [Porphyromonas gingivalis SJD2]12/06/1312/12/14DashaDv1
(CLOSED) Structural-Bioinformatics04/24/1705/08/17AnnaSophalK9
(CLOSED) Sugar Binding Puzzle07/24/1207/30/12beta_helix6
(CLOSED) sup07/09/1307/10/13bionano10
(CLOSED) Sup'bio0204/24/1404/27/14isaa5412
(CLOSED) Sup'BioFold07/04/1307/05/13Darksliver4
(CLOSED) Supbiotech A04/24/1404/25/14ChloeAudrey10
(CLOSED) Super Easy04/01/1705/03/17AndriiMiller1
(CLOSED) Super Freestyle03/27/1304/27/13super_Nethergirl1
(CLOSED) Super Freestyle03/27/1304/27/13super_Nethergirl1
(CLOSED) Superkittyhorse proteins09/27/1012/31/10avapenny1
(CLOSED) Swaggy Folding12/10/1512/15/15Atsnider0
(CLOSED) SymmetryTest12/07/1512/08/15Batz1
(CLOSED) Target 611 - Test08/29/1008/30/10Cyanoia1
(CLOSED) Tau Protein (441 residue htau40)01/23/1312/31/16jinguluninja1
(CLOSED) Tbf102/20/1307/17/13Rivsie1
(CLOSED) Team 11 Test03/18/1703/19/1750SciOne2
(CLOSED) Team 5 Project03/12/1703/31/1728SciOne5
(CLOSED) team 6!!03/21/1703/25/1720SciOne5
(CLOSED) Test11/08/1511/30/15Skulduggery1
(CLOSED) Test10/15/1010/16/10Pyrohmstr1
(CLOSED) Test10/15/1010/23/10Pyrohmstr1
(CLOSED) test08/09/1208/09/13chingsong0
(CLOSED) Test03/03/1403/05/14PeerPride1
(CLOSED) test12/11/1412/12/14Bloch_Party1
(CLOSED) test02/12/1402/13/14l_like2
(CLOSED) Test03/03/1403/13/14PeerPride0
(CLOSED) test12/12/1412/13/14bkoep1
test05/24/1112/31/19gurch62
(CLOSED) Test05/12/1305/17/13MurloW1
(CLOSED) Test07/15/1107/01/12berus1
(CLOSED) test10/25/1010/31/13centic1
(CLOSED) test03/03/1503/04/15boltax1
(CLOSED) test03/07/1703/08/17lhatsk1
(CLOSED) test03/11/1203/12/12RedVenom1
(CLOSED) Test11/23/1511/24/15crostomily0
(CLOSED) test09/19/1009/20/10rangerQ1
(CLOSED) test01/24/1301/01/14sonneys1
(CLOSED) test10/12/1110/13/11laurenting1
(CLOSED) test09/27/1406/25/15srettie1
(CLOSED) Test03/12/1703/14/1728SciOne1
(CLOSED) Test06/04/1106/11/11Zeljko1
(CLOSED) test03/13/1203/20/12mk181
(CLOSED) Test03/09/1307/20/13mind_hack1
(CLOSED) Test04/21/1206/14/13paulsen0
(CLOSED) test07/04/1307/05/13Raphsup4
(CLOSED) test12/02/1512/03/15seantan0
(CLOSED) test08/19/1008/20/10beta_helix1
(CLOSED) test04/16/1204/22/12test_account141
(CLOSED) test10/01/1410/01/15Orcus1
(CLOSED) test08/13/1508/14/15sungwon1
(CLOSED) Test08/21/1008/23/10Acida-21
(CLOSED) TEST06/14/1106/18/11csac19592
(CLOSED) Test08/12/1408/13/14antoine7771
(CLOSED) test07/12/1607/13/16guolab1
(CLOSED) test08/19/1308/21/13bkoep1
(CLOSED) test01/05/1101/06/11omelet bob1
(CLOSED) test01/05/1101/06/11omelet bob1
(CLOSED) Test01/06/1101/13/11Roedl1
(CLOSED) test04/25/1404/26/14kasper421
(CLOSED) Test06/15/1206/16/12xDust0
(CLOSED) Test12/03/1612/04/16Justine181
(CLOSED) Test07/28/1307/31/13violinist670
(CLOSED) test01/12/1201/31/12gurimmer0
(CLOSED) test01/12/1201/31/12gurimmer1
(CLOSED) test02/10/1502/10/16silverberg3
(CLOSED) Test10/14/1610/16/16immac6361
(CLOSED) test 109/23/1510/31/15honeypiebeatles1
(CLOSED) test 110/20/1710/31/17cxlpku1
(CLOSED) test 109/27/1609/29/16ionickiwi1
(CLOSED) test 111105/15/1512/31/15cyj1013660
(CLOSED) Test 12312/07/1212/14/12RicGray1
(CLOSED) Test 203/25/1304/30/13RicGray0
(CLOSED) test 211/09/1512/25/15Skulduggery1
test 205/24/1112/31/29gurch1
(CLOSED) Test 32703/27/1403/28/14NickyCGS1
(CLOSED) Test 3V1A03/02/1705/02/17Scopper1
(CLOSED) Test 4251404/25/1404/26/14NickyCGS1
(CLOSED) Test 61112/27/1312/28/13NickyCGS1
(CLOSED) test 80 segment 11/23/1411/26/15brgreening1
(CLOSED) test 80 trimer 32703/27/1403/28/14NickyCGS2
(CLOSED) test abeta05/16/1405/17/14Seth Cooper1
(CLOSED) test abeta 205/16/1405/17/14Seth Cooper1
(CLOSED) Test area06/24/1012/31/10mat7471
(CLOSED) Test area - HIV protease06/24/1012/31/10mat7471
(CLOSED) test arla02/07/1402/14/14arlap1
(CLOSED) test arla 202/07/1402/14/14arlap1
(CLOSED) test arla 302/07/1402/14/14arlap0
(CLOSED) test asdfg07/31/1208/02/12Asbiorn0
(CLOSED) Test auto04/11/1504/12/15wudoo0
(CLOSED) Test contest11/23/1511/24/15seantan1
(CLOSED) Test Contest11/06/1301/31/14Roukess1
(CLOSED) Test contest02/14/1402/15/14NickyCGS1
(CLOSED) test contest02/07/1702/28/17brbfold1
(CLOSED) Test contest02/23/1202/23/13f1pokerspeed1
(CLOSED) Test Contest - ML05/01/1608/31/16MrMark20143
(CLOSED) Test Contest 32703/27/1403/28/14NickyCGS1
Test contest for a project at TU Clausthal06/20/1506/21/18Shanschke1
(CLOSED) Test Contest for Lorna02/17/1702/19/17dsilva.l1
(CLOSED) Test Custom Contest - dev0310/09/1710/12/17ronnygeo1
(CLOSED) Test DANIELLE10/04/1510/17/15petetrig1
(CLOSED) Test design05/29/1405/30/14Valectar1
(CLOSED) test dimer09/03/1309/06/13jsorr1
(CLOSED) Test Dimer06/30/1407/28/14jflat061
(CLOSED) Test field 106/01/1206/02/12phi161
(CLOSED) test for M-SBVfCT10/12/1210/13/12tjbertram0
(CLOSED) test frizzled05/16/1405/17/14Seth Cooper1
(CLOSED) test nanog05/16/1405/17/14Seth Cooper1
(CLOSED) test nanog06/17/1406/18/14test_account11
(CLOSED) test of SmfT0743fCT10/12/1210/13/12tjbertram0
(CLOSED) Test Post Please Ignore11/24/1411/25/14rjking010
(CLOSED) Test Protein06/12/1206/12/13kurenan1
(CLOSED) Test Protein12/26/1103/31/12kurenan1
(CLOSED) Test Puzzle12/18/1112/19/11kurenan1
(CLOSED) Test Puzzle to Fix Client02/08/1202/29/12beta_helix23
(CLOSED) Test Range- HIV Lab09/01/1009/05/10buddy10181
(CLOSED) Test Scripting - ZKora11/08/1211/30/12ZKora1
(CLOSED) Test test01/06/1201/13/12smfuchs1
(CLOSED) test test11/08/1411/30/14obiwan0
(CLOSED) test test11/10/1411/30/14obiwan0
(CLOSED) test test05/29/1005/30/10CharlieFortsConscience1
(CLOSED) test test05/19/1205/20/12Stolaf1
(CLOSED) test test 1234506/04/1406/05/14Seth Cooper0
(CLOSED) Test Trimer06/30/1407/28/14jflat061
(CLOSED) Test your PC power12/03/1309/30/16Bruno Kestemont59
(CLOSED) Test, festyn bibs05/15/1405/19/14Behoston2
(CLOSED) test-contest02/01/1202/02/12climax1411
(CLOSED) test-tintin-hiv11/22/1611/23/16tintin13431
(CLOSED) test0009/29/1109/30/11spacevet1
(CLOSED) test07110/07/1110/09/11b3au0711
(CLOSED) test10006/10/1406/11/14Seth Cooper1
(CLOSED) Test121202/14/1402/15/14NickyCGS1
(CLOSED) test12311/07/1711/08/17horowsah1
(CLOSED) Test131302/14/1402/15/14NickyCGS1
(CLOSED) test15006/10/1406/11/14Seth Cooper1
(CLOSED) Test207/15/1107/17/11berus1
(CLOSED) Test203/12/1703/19/1728SciOne1
(CLOSED) Test2 06/10/1106/17/11Zeljko0
(CLOSED) test211/06/1301/31/14Roukess1
(CLOSED) Test202/23/1202/23/139ct291
(CLOSED) test2003/20/1403/20/17Jean-Bob1
(CLOSED) test20006/10/1406/11/14Seth Cooper1
(CLOSED) Test3271403/27/1403/28/14NickyCGS1
(CLOSED) testA108/24/1708/25/17ksz1
(CLOSED) Testacular02/22/1503/30/15HerobrinesArmy0
(CLOSED) testcol4a3bp07/18/1312/19/13G_H_B0
(CLOSED) testcol4a3bp207/18/1312/19/13G_H_B1
(CLOSED) testComm07/22/1708/20/17dsilva.l2
(CLOSED) Testdudetest01/31/1202/29/12testdudetest1
Teste02/25/1602/12/19NotEvenTryingM81
(CLOSED) tester06/01/1206/02/12CharlieFortsConscience2
(CLOSED) testing10/31/1411/01/14ipcfg1
(CLOSED) Testing 08/23/1709/21/17Dr.Chi0
(CLOSED) testing12/04/1512/08/15vkalas1
(CLOSED) Testing 15003/09/1503/27/15HerobrinesArmy1
(CLOSED) testing Foldit minimize split intein 3NZM01/02/1401/02/16sagearbor2
(CLOSED) Testing ground 312/30/1312/30/14slofgren1
(CLOSED) Testing Group Contests01/09/1301/10/13auntdeen0
(CLOSED) testing own script05/13/1312/31/16Morus1
(CLOSED) Testing Puzzle01/15/1301/31/13thoyt20121
(CLOSED) Testing puzzle06/03/1210/03/12Ch Garnier6
(CLOSED) testing the contest04/15/1005/15/10mat7473
(CLOSED) Testing20005/30/1405/31/14NickyCGS1
(CLOSED) Testmarch271403/27/1403/28/14NickyCGS1
(CLOSED) testmb02/10/1502/12/15jakelmer1
(CLOSED) Test_steveB12/01/1112/08/11steveB1
(CLOSED) TFP11/21/1412/31/14chingsong21
(CLOSED) TFP20011/25/1412/31/14chingsong22
(CLOSED) TFS dwewf04/03/1204/04/12jperoff2
(CLOSED) The AS challenge03/31/1104/17/11AgentScience0
(CLOSED) The Beginner contest06/24/1006/30/10Gebauer1
(CLOSED) the contest10/21/1110/28/11Mozzi4
(CLOSED) The Final Model05/15/1305/16/13WheeDhee8
(CLOSED) The Fountain of Youth03/20/1303/31/16deinfrank0
(CLOSED) the fun alot08/28/1708/29/17randcvn0
(CLOSED) the grand final08/17/1012/31/13cyclic32
(CLOSED) the great vacation raceoff06/01/1309/30/13shadow3450
(CLOSED) the ice dragons playhouse02/06/1502/28/15the ice dragon3
(CLOSED) The Marathon of Foldit - New Chapter02/01/1402/28/17Bruno Kestemont126
(CLOSED) The Marathon of Foldit: 611 residues big puzzle chalenge12/03/1312/02/16Bruno Kestemont22
(CLOSED) The National Protein Test08/22/1408/29/14azak20021
(CLOSED) THE OCTAGON v202/07/1302/08/13nomatic1
(CLOSED) the only tournament here! (for now)05/10/1106/10/11shrock2
(CLOSED) the protein09/07/1209/26/15river123451
(CLOSED) The science is pure science08/15/1008/21/10Dj-P1
(CLOSED) the testing puzzle!07/09/1208/31/12drumpeter18yrs9yrs0
(CLOSED) The unbreakable Loops05/30/1109/22/11lukis0
(CLOSED) Theoredoxin01/31/1201/31/14PeptideMuncher1
(CLOSED) thiinngyyy cathole08/19/1408/31/14aguy770
(CLOSED) thing03/03/1303/04/13erek1
(CLOSED) This freestyle puzzle03/18/1204/30/12GirichMS1
(CLOSED) This freestyle puzzle has mutable residues and allows you to add or delete residues05/04/1605/06/16zduzgun1
(CLOSED) Threading01/06/1101/13/11AmyLia3301
(CLOSED) TIM 20009/01/1609/09/16Rsteele71
(CLOSED) TIM Barrel09/01/1609/09/16Rsteele71
(CLOSED) TIM Barrel Design08/29/1609/02/16Rsteele71
(CLOSED) TIM Barrel Design08/29/1609/02/16Rsteele71
(CLOSED) Time to Cure Cancer- Once and For All!03/01/1106/01/11tyler091112
(CLOSED) tinglei03/09/1103/10/11tinglei7110
(CLOSED) Tiroler Nacht der Forschung04/25/1204/29/12obiwan1
(CLOSED) Tiroler Nacht der Forschung 204/25/1204/29/12obiwan1
(CLOSED) To have fun07/29/1107/20/14mayumiao1
(CLOSED) Total freedom12/09/1312/10/13ahaddad1
(CLOSED) Toxic Gluten Molecule07/11/1207/29/12scooper146
(CLOSED) Toxic Gluten Peptide07/11/1207/29/12scooper146
(CLOSED) TR62410/25/1111/06/11beta_helix2
(CLOSED) Transmembrane Molecule Modelling06/01/1206/30/12Beerwing1
(CLOSED) Trest03/02/1403/13/14PeerPride1
(CLOSED) Trial08/17/1508/20/15OlgaRadchuk1
(CLOSED) trial02/04/1502/08/15jort1
(CLOSED) Trichoplusia ni. Gloverin Protein10/12/1212/31/13ainstein0011
(CLOSED) Trimer design12/28/1312/28/14arivero1
(CLOSED) trimer test12/11/1312/31/15syoifczeri1
(CLOSED) Triple Helix DNA10/03/1310/31/15Tovi1
(CLOSED) Trm706/14/1206/21/12v0lfg0ng1
(CLOSED) TrollFace games01/12/1701/14/17TrollFace20021
Trp-Cage04/14/1504/14/18ivalnic1
(CLOSED) Truncated human ryanodine receptor 202/21/1105/31/11Fnallerdaller1
(CLOSED) Truncated Human Ryanodine Receptor 2 v202/22/1105/29/11Fnallerdaller1
(CLOSED) Trying something out :) pardon01/31/1202/29/12PeptideMuncher1
(CLOSED) Trying to make a Propeller!10/08/1310/31/13wisky1
(CLOSED) Tspan peptide 203/03/1204/01/12rwarn1
Twelver02/12/1712/31/20ScratchKid1
(CLOSED) Twisting of the protein (v.2)01/01/1101/31/11Dj-P5
(CLOSED) Twisting of the protein (v1.0)12/28/1004/15/11Dj-P11
(CLOSED) Two Day Beat Back the Boredom Puzzle01/24/1301/26/13auntdeen14
(CLOSED) Two symmetric chains, 40 segments each; all can be designed.05/03/1605/05/16zduzgun1
(CLOSED) UCDS April Contest04/01/1304/30/13UCDS_A024
(CLOSED) UCDS Test Contest03/25/1304/30/13UCDS_Test3
(CLOSED) UCSF DNA Challenge 10/25/1111/06/11beta_helix3
(CLOSED) UCSF Intro Puzzle10/21/1110/25/11beta_helix21
(CLOSED) UNC SHARP Contest 107/12/1307/31/13jetaiken3
(CLOSED) UNC SHARP Contest 207/12/1307/31/13Sharp30
(CLOSED) UNC SHARP Contest 207/12/1307/31/13jetaiken1
(CLOSED) University of Edinburgh Biophysical chemistry workshop 201703/21/1707/01/17jmichel809
(CLOSED) Unl. Sandbox12/02/1012/31/10kevinjh1
(CLOSED) Urena01/11/1401/12/14robertito1
(CLOSED) USTB work10/09/1510/10/15chingsong1
(CLOSED) utaca10/25/1311/15/16utaca1
(CLOSED) Valentine's day11/06/1302/14/14Compassionate1
(CLOSED) vanabin10/10/1410/11/14polli81
(CLOSED) Vandeweyer_Protein04/22/1304/30/13gvandeweyer1
(CLOSED) variable freestlye design12/21/1112/31/11sum0
(CLOSED) variable freestlye design12/21/1112/31/11sum1
(CLOSED) Variable Length Protein Structure09/29/1612/31/16Atombryan1
(CLOSED) Varriable Freestyle08/30/1209/30/12Dishrat0060
(CLOSED) vgsetgethgtr rgwethg02/14/1302/14/16oxyi1
(CLOSED) vhcvhvghgvhjhghjhgjkjyhjgjhjkhkjyh05/18/1105/19/11oxyi1
(CLOSED) Viral accessory protein05/03/1605/22/16Zephrin1
(CLOSED) virus09/02/1212/28/12Aqua8171
(CLOSED) Virus Matrix07/15/1308/15/13dbuske1
(CLOSED) vlp de filette04/23/1405/31/14alexram991
(CLOSED) VopX09/20/1110/20/11rabidfurball1
(CLOSED) vroom01/02/1201/28/12kasmol1
(CLOSED) vroom202/24/1203/24/12kasmol2
(CLOSED) We are bored - Design Trimer Contest08/02/1508/16/15jamiexq9
(CLOSED) Week 5 Camp BIOmed08/03/1508/07/15apklock6
(CLOSED) what is this???12/02/1312/05/13Niiikola2
(CLOSED) Whatever You Want12/20/1312/21/13The Super Cat0
(CLOSED) Why not, really?12/22/1001/22/11anthunk10
(CLOSED) win or lose11/28/1512/01/15spider8760
(CLOSED) Wisks Contest04/06/1304/30/13WiskIRC2
(CLOSED) Wolfer's Class05/31/1206/06/12NTWII4
(CLOSED) Wolfer's Class 205/31/1206/06/12NTWII1
(CLOSED) working in a mutate script09/07/1209/01/13BitSpawn1
(CLOSED) WSC Bioc 1 F17 EC11/03/1711/18/17jcnichols15
(CLOSED) WSC Bioc Spring 201603/25/1604/10/16jcnichols18
(CLOSED) WSU Bioc (S13)02/18/1302/20/13jcnichols37
(CLOSED) WSU Bioc 1 S1804/05/1704/23/17jcnichols16
(CLOSED) WSU Bioc Fall 1610/20/1611/03/16jcnichols2
(CLOSED) WSU Fall 16 Biochemistry11/02/1611/20/16jcnichols17
(CLOSED) Wulff's Fantastic Core Challenge01/27/1402/28/14-Jacoby-12
(CLOSED) ww domain01/08/1301/31/13deans2
(CLOSED) x01/22/1502/18/15jakelmer1
(CLOSED) XY10/28/1010/29/10PdB241
(CLOSED) xz 07 biotechnology 09/02/1012/31/10xuchenidea0
(CLOSED) yahya09/17/1301/13/16yahyamohammed0
(CLOSED) Yay!11/10/1511/17/15code cat1
(CLOSED) Yes07/24/1207/25/12JBrown23222
(CLOSED) ygkas08/13/1308/17/14sotk2
(CLOSED) ygkas 1-8008/23/1008/23/11sotk1
(CLOSED) ygkas1 40-12008/26/1008/26/11sotk1
(CLOSED) ygkas208/11/1008/11/11sotk0
(CLOSED) Ykl071w Amino acid sequence05/09/1105/31/11Dendroid1
(CLOSED) YneM07/10/1308/17/13canthony91
(CLOSED) yo10/31/1411/01/14otterballer1
(CLOSED) Yo dawg11/25/1311/30/13HelloKittyIslandAdventure1
(CLOSED) you betta win09/19/1209/23/12SOARcmoo1
You choose the number of residues02/11/1502/28/18michaeled31419
(CLOSED) yoyoyo10/24/1512/03/15Aria Deng2
(CLOSED) Yu's lab C2E103/11/1203/01/15lijiahua19841
(CLOSED) yuqianhengyuan06/26/1706/27/17yuqianhengyuan0
(CLOSED) zekrom09/30/1301/01/14canadajan0
(CLOSED) zhustb08/26/1208/25/13chingsong1
(CLOSED) Zia05/17/1608/27/16Ziauddin Ahmer0
(CLOSED) zincfingers11/20/1402/18/15chingsong21
(CLOSED) zzzzzzzzz06/10/1006/11/10yjh0
(CLOSED) [DEPRECATED] GTPase Ras long run *Anyone can join!*01/28/1412/31/15AsDawnBreaks128
(CLOSED) все надоемо09/24/1209/30/12egik19971
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons