| vghubzysd rx | 07/31/11 | 12/31/13 | oxyi | 1 |
| (CLOSED) 'Brave New World' Class Puzzle | 04/22/10 | 05/02/10 | beta_helix | 25 |
| (CLOSED) 'for everyone | 12/04/10 | 01/09/11 | anthunk | 67 |
| (CLOSED) (Closed) PEP Private Contest II | 04/12/12 | 04/18/12 | prolylendopeptidase | 4 |
| (CLOSED) (Closed) PEP Private Contest III | 05/22/12 | 05/31/12 | prolylendopeptidase | 3 |
| (CLOSED) 1 | 08/19/10 | 08/31/10 | lipasesucks | 1 |
| (CLOSED) 100 amino acids | 12/09/12 | 12/20/12 | margo311 | 0 |
| (CLOSED) 100 amino acids | 12/09/12 | 12/20/12 | margo311 | 1 |
| (CLOSED) 11 | 12/20/12 | 01/29/13 | ScottNDean | 1 |
| (CLOSED) 12 | 08/19/10 | 08/31/10 | lipasesucks | 1 |
| (CLOSED) 13-mer toxic peptides | 05/23/12 | 05/31/12 | hanhnguyen14 | 1 |
| (CLOSED) 2 weeks, 80 segment design. | 04/27/13 | 05/11/13 | MurloW | 4 |
| (CLOSED) 20 seg script test | 06/05/10 | 12/31/10 | srssmith92 | 1 |
| (CLOSED) 2011-11 small Freestyle | 02/22/11 | 12/31/11 | Crashguard303 | 4 |
| (CLOSED) 3 day speed folding | 01/24/13 | 01/27/13 | jamiexq | 15 |
| (CLOSED) 33mer From Shan et. al. | 05/23/12 | 06/30/12 | scooper14 | 2 |
| (CLOSED) 3G | 03/25/13 | 04/30/13 | rvalensia | 1 |
| (CLOSED) 40 aa class test | 09/27/12 | 12/01/12 | rsingiser | 1 |
| (CLOSED) 40 Seg Design Contest | 04/15/10 | 04/20/10 | TheGUmmer | 3 |
| (CLOSED) 40 segment | 07/16/10 | 07/18/10 | icreatemac | 0 |
| 40 Segment Chain | 04/22/12 | 04/30/14 | michaeled314 | 1 |
| (CLOSED) 40 segment Freestyle Design. 2 weeks. | 03/22/13 | 04/06/13 | MurloW | 3 |
| (CLOSED) 430 | 08/03/11 | 08/04/11 | laurabee | 1 |
| 500 residue freestyle! | 08/16/12 | 08/20/14 | meatexplosion | 3 |
| (CLOSED) 565645646 | 06/11/10 | 06/12/10 | yjh | 0 |
| 576i | 05/21/11 | 12/31/14 | oxyi | 1 |
| (CLOSED) 5cDraw Gutstopen | 04/22/13 | 04/27/13 | ManVsYard | 1 |
| (CLOSED) 80 and everyone | 05/15/12 | 12/31/12 | Alakazam Einstein | 73 |
| (CLOSED) 80 segment freestyle design. 1 month. | 01/29/13 | 02/28/13 | MurloW | 10 |
| (CLOSED) 80segment | 07/12/10 | 07/31/10 | asianboy26 | 1 |
| (CLOSED) >R0023 SP18154A, Streptococcus pneumoniae, 100 residues | 12/09/12 | 12/25/12 | margo311 | 1 |
| (CLOSED) >R0023 SP18154A, Streptococcus pneumoniae, 100 residues MRAQSFFLTFSFIRSKIKLALNKGVLNMIEITYIDASKNERTVTFESYEDFERSQQACLI GVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN | 12/02/12 | 12/10/12 | margo311 | 1 |
| (CLOSED) ?? | 12/20/10 | 01/01/11 | reedbc | 1 |
| (CLOSED) a | 07/11/10 | 07/25/10 | asianboy26 | 1 |
| (CLOSED) a | 11/27/11 | 12/19/11 | JimmyFraktal | 1 |
| A Battle in Design | 03/14/13 | 03/14/14 | TheWhiteLord5 | 0 |
| (CLOSED) A Computer Tester | 12/09/11 | 12/08/12 | mat747 | 2 |
| (CLOSED) A Freestyle Design 20 Open to all | 08/14/11 | 08/31/12 | itskimo | 288 |
| (CLOSED) A Freestyle Design 40 Open to all | 08/14/11 | 08/31/12 | itskimo | 68 |
| (CLOSED) A Freestyle Design 80 Open to all | 08/14/11 | 09/30/12 | itskimo | 69 |
| (CLOSED) A GTPase Ras Open To All | 08/27/11 | 09/30/12 | itskimo | 131 |
| (CLOSED) A HIV Protease open to all | 08/27/11 | 09/30/12 | itskimo | 496 |
| (CLOSED) A london Olympic contest! | 08/05/12 | 08/12/12 | junh821 | 4 |
| (CLOSED) a test of rich disordered seq | 03/19/13 | 03/31/13 | wangxinyu_cn | 1 |
| (CLOSED) a.l | 07/13/10 | 07/15/10 | asianboy26 | 1 |
| (CLOSED) AATG TK Bioteknologi | 10/04/10 | 10/08/10 | thomas.holm@gmail.com | 1 |
| (CLOSED) Acida's test | 09/22/10 | 09/30/10 | Acida-2 | 15 |
| (CLOSED) ACP | 10/27/11 | 10/12/12 | mike r | 0 |
| (CLOSED) ACP | 10/27/11 | 10/12/12 | mike r | 1 |
| (CLOSED) Acyl Hydrolase | 04/03/12 | 04/04/12 | MichaelGasse | 1 |
| (CLOSED) Adelphi FHB Design | 05/02/13 | 05/12/13 | ligandfinder | 6 |
| (CLOSED) Ael | 05/20/12 | 06/03/12 | Aralys | 1 |
| (CLOSED) aendgraend tested contests | 06/09/10 | 06/13/10 | aendgraend | 1 |
| (CLOSED) AIDS | 12/08/10 | 12/31/11 | colonelpaco | 1 |
| (CLOSED) Aids Security | 09/02/10 | 01/22/11 | Gaara | 1 |
| (CLOSED) aj | 09/23/11 | 09/24/11 | ilikeike | 1 |
| (CLOSED) Alabudzki | 11/06/10 | 12/31/10 | alabudzki | 1 |
| (CLOSED) Albert | 11/13/12 | 11/14/12 | Albert_tanjaya | 2 |
| (CLOSED) Align-it | 08/14/10 | 08/21/10 | Arbot360 | 20 |
| (CLOSED) Alignment | 10/02/10 | 12/31/10 | sielenk | 1 |
| (CLOSED) Alignment | 10/02/10 | 12/31/10 | sielenk | 0 |
| (CLOSED) Alignment battle | 12/12/10 | 12/31/10 | Nikaeo | 4 |
| (CLOSED) Alignment test | 07/23/11 | 07/24/11 | harvardman | 0 |
| (CLOSED) Alignment tool (join link in desc) | 10/26/11 | 12/31/11 | riking | 7 |
| (CLOSED) Another Beat Back the Boredom Old Style | 01/24/13 | 01/26/13 | auntdeen | 19 |
| (CLOSED) Another Contest | 04/17/10 | 04/22/10 | TheGUmmer | 2 |
| (CLOSED) any one can join too | 06/26/11 | 09/01/11 | plh | 1 |
| (CLOSED) anyone can join (actually) | 07/05/11 | 12/16/11 | madpenguin | 0 |
| (CLOSED) Anyone Can Join (freestyle design 80) | 07/19/10 | 07/18/11 | spy club | 202 |
| (CLOSED) Anyone can join, HIV Protease, OPEN TO ALL | 01/06/13 | 02/10/13 | Phillipthegreat | 34 |
| (CLOSED) Aotearoa's Ghost | 04/23/10 | 05/22/10 | Renton | 1 |
| (CLOSED) Aotearoa's Romance | 05/03/10 | 12/24/10 | Renton | 1 |
| (CLOSED) AP BIO Extra Credit | 09/24/10 | 09/25/10 | jesalomone11 | 6 |
| (CLOSED) AP Bio Puzzle 1 | 11/15/12 | 11/18/12 | APTeach235 | 1 |
| arabic group | 09/22/11 | 09/22/14 | ahmed magdy | 1 |
| (CLOSED) artificial muscle | 03/25/12 | 03/31/12 | AkimotoYuki | 0 |
| (CLOSED) asdfadf | 07/05/10 | 07/29/10 | RoboMonkey | 1 |
| (CLOSED) asf | 11/27/11 | 11/30/11 | JimmyFraktal | 0 |
| (CLOSED) assasa | 06/10/10 | 06/11/10 | yjh | 1 |
| (CLOSED) AT Testing | 12/22/10 | 12/26/10 | anthunk | 1 |
| (CLOSED) AT Testing Too | 12/22/10 | 12/26/10 | anthunk | 1 |
| (CLOSED) Atoh1 Atonal homolog 1 | 07/11/11 | 08/01/11 | RANimick | 0 |
| BattleGrounds....v.5655.88 | 08/31/10 | 08/24/13 | InsaneGamer1457 | 1 |
| (CLOSED) BCHS 3201 | 09/26/11 | 11/30/11 | Fotis NKS | 0 |
| (CLOSED) BCHS 3201 | 09/26/11 | 11/30/11 | Fotis NKS | 0 |
| (CLOSED) BCHS3201 | 02/20/13 | 02/25/13 | fahdkabani | 3 |
| (CLOSED) Beat it! | 08/17/12 | 08/18/12 | Quinton830 | 0 |
| (CLOSED) begginer | 01/10/12 | 01/19/12 | bobbyjoejr | 0 |
| (CLOSED) Beginner Alignment Puzzle | 12/06/11 | 12/31/11 | kitek314_pl | 1 |
| (CLOSED) Beginner Alignment puzzle | 11/04/10 | 11/11/10 | science.nerd | 0 |
| (CLOSED) Beginner Alignment Puzzle | 01/02/11 | 01/01/12 | maksimlekler | 1 |
| (CLOSED) Beginner HIV protease | 08/07/12 | 08/10/12 | rarkenin | 1 |
| (CLOSED) Beginner puzzle copy | 05/31/10 | 05/18/12 | Krog | 1 |
| (CLOSED) Beginners game | 04/11/11 | 04/17/11 | Zsolesz84 | 0 |
| (CLOSED) Beginning Alignment Puzzle | 02/04/11 | 02/12/11 | ltchong | 0 |
| (CLOSED) best score | 09/17/10 | 09/21/10 | Willbee | 1 |
| (CLOSED) Beta-carotene dioxygenase | 10/13/10 | 11/05/10 | mbarnkob | 0 |
| (CLOSED) BHS - Nanog Contest | 04/24/12 | 05/12/12 | katievh | 125 |
| (CLOSED) BiChE Easy puzzle | 12/08/10 | 12/10/10 | ejf3c | 1 |
| (CLOSED) BIG CASP9 contest | 08/23/11 | 02/01/12 | wudoo | 68 |
| Big Win | 08/14/12 | 12/31/15 | alexlan | 0 |
| (CLOSED) binding motif test | 02/16/11 | 02/03/12 | ceventer | 1 |
| (CLOSED) Bio 152EC | 02/06/12 | 02/16/12 | smfuchs | 1 |
| Bio chem assignment | 02/16/13 | 02/15/14 | sonneys | 0 |
| (CLOSED) Bio152 | 12/13/12 | 01/31/13 | smfuchs | 1 |
| (CLOSED) BIo152 EC | 02/07/12 | 02/16/12 | smfuchs | 1 |
| (CLOSED) Bioc 2nd chance (S13) | 02/28/13 | 03/02/13 | jcnichols | 3 |
| (CLOSED) Bioc EC #2 | 10/16/12 | 10/17/12 | jcnichols | 18 |
| (CLOSED) Bioc F12 EC#1 | 10/11/12 | 10/15/12 | jcnichols | 30 |
| (CLOSED) Bioc S13 2nd chance | 02/26/13 | 02/28/13 | jcnichols | 1 |
| (CLOSED) Bioc WSC | 03/06/12 | 03/08/12 | jcnichols | 27 |
| (CLOSED) Bioc WSC EC | 03/06/12 | 03/07/12 | jcnichols | 1 |
| (CLOSED) Bioc WSC EC | 03/25/12 | 03/31/12 | jcnichols | 27 |
| (CLOSED) Bioc670_1 | 01/22/11 | 02/10/11 | bkuhlman | 24 |
| biochem assignment | 02/16/13 | 02/15/14 | sonneys | 1 |
| (CLOSED) BioClass | 04/11/12 | 04/15/12 | sarahod23 | 1 |
| (CLOSED) biocon | 07/26/12 | 07/27/12 | aurabum | 1 |
| (CLOSED) BioContest | 01/27/11 | 01/28/11 | cbehling | 2 |
| (CLOSED) bioc_3 | 01/26/12 | 02/14/12 | bkuhlman | 18 |
| (CLOSED) Bioc_670_2 | 01/26/12 | 02/10/12 | bkuhlman | 1 |
| (CLOSED) bioc_670_design | 02/01/12 | 02/15/12 | bkuhlman | 19 |
| (CLOSED) Bioc_670_Protease | 01/26/12 | 02/10/12 | bkuhlman | 1 |
| (CLOSED) Bioinfor Kaset | 09/19/10 | 09/27/10 | kiattawee | 17 |
| (CLOSED) bioinformatic task for exam | 12/09/12 | 12/20/12 | margo311 | 0 |
| (CLOSED) bioinformatic task for exam | 12/09/12 | 12/20/12 | margo311 | 0 |
| (CLOSED) bioinformatic task for exam | 12/09/12 | 12/20/12 | margo311 | 1 |
| (CLOSED) Biokemi contest | 03/05/13 | 03/06/13 | MagnusA | 1 |
| (CLOSED) biol200-3-23-11 | 04/04/11 | 04/09/11 | gabhsa | 12 |
| (CLOSED) Biology-NanogContest | 02/03/12 | 02/29/12 | Seth Cooper | 99 |
| (CLOSED) Biotech WFB 1 | 03/28/13 | 04/09/13 | KBrown | 2 |
| (CLOSED) Biotech WFB HIV | 03/28/13 | 04/09/13 | KBrown | 0 |
| (CLOSED) bjarke join mig | 10/04/10 | 10/05/10 | aske2010 | 2 |
| (CLOSED) blabla | 03/17/12 | 03/24/12 | ccilia | 1 |
| (CLOSED) Black box42 | 02/09/11 | 02/11/11 | DaVinci21 | 1 |
| (CLOSED) Black Nest of doom | 11/23/12 | 12/31/12 | mattymoe | 0 |
| (CLOSED) Black Nest of doom | 11/23/12 | 12/31/12 | mattymoe | 1 |
| (CLOSED) Black Nest of Doom | 11/23/12 | 12/31/12 | mattymoe | 2 |
| (CLOSED) Blank | 01/04/11 | 12/31/11 | kevinjh | 1 |
| (CLOSED) BLARG | 12/20/11 | 12/21/11 | Chappers | 0 |
| (CLOSED) BLARG | 12/20/11 | 12/21/11 | Chappers | 2 |
| (CLOSED) Blarghs contest | 04/30/12 | 12/31/12 | blargh123 | 1 |
| (CLOSED) BMI 206 test contest - protease | 10/12/11 | 10/13/11 | amelie.stein | 1 |
| (CLOSED) BMI 206 test contest - Ras | 10/12/11 | 10/14/11 | amelie.stein | 1 |
| (CLOSED) bonebreake | 09/09/10 | 09/17/10 | baeda | 1 |
| (CLOSED) BP's 611 | 09/10/10 | 09/11/10 | Bletchley Park | 1 |
| (CLOSED) bugster | 03/05/11 | 04/30/11 | alex2011 | 1 |
| (CLOSED) C21ECL | 02/21/12 | 02/25/12 | lijiahua1984 | 1 |
| (CLOSED) C21ECL-1 | 02/21/12 | 02/24/12 | lijiahua1984 | 1 |
| (CLOSED) Calzolai | 09/01/10 | 11/08/10 | iRob | 0 |
| (CLOSED) Cameron | 04/03/12 | 04/04/12 | Cameron Baxendale | 0 |
| (CLOSED) Cameron | 04/03/12 | 04/04/12 | Cameron Baxendale | 1 |
| (CLOSED) Can you foldit? | 01/03/12 | 04/20/12 | S-Man | 0 |
| (CLOSED) Can you win? | 01/06/12 | 01/07/12 | thekidsglenn7 | 1 |
| cancer help | 12/06/12 | 12/31/13 | jordansapp1 | 2 |
| (CLOSED) Cancer Puzzle | 12/11/11 | 12/25/11 | EzraThexton | 1 |
| (CLOSED) Cancer Puzzle | 10/09/12 | 10/11/12 | beta_helix | 1 |
| (CLOSED) Cancer Treatment Contest | 03/24/12 | 04/24/12 | DaVinci21 | 1 |
| (CLOSED) CASP 9: Nycticorax nycticorax's mystery. | 01/01/11 | 01/15/11 | Dj-P | 14 |
| (CLOSED) CASP Training | 02/18/12 | 04/30/12 | nealk | 1 |
| (CLOSED) casp training | 10/20/11 | 10/31/11 | vk1982 | 1 |
| (CLOSED) CASP training puzzle | 01/02/11 | 01/01/12 | maksimlekler | 1 |
| (CLOSED) CASP9 611 residue | 05/29/10 | 06/15/10 | Mark- | 4 |
| (CLOSED) CASP9 targed Design test, all welcome | 03/01/11 | 07/01/11 | tyler0911 | 1 |
| (CLOSED) CASP9 Target 611 | 10/24/10 | 11/30/10 | cd11 | 1 |
| (CLOSED) CASP9 Target 611 residue protein | 01/02/11 | 01/01/12 | maksimlekler | 1 |
| CASP9 Target 611 residue protein | 06/18/12 | 06/18/13 | meatexplosion | 2 |
| (CLOSED) CASP9 target Design? | 01/02/11 | 01/01/12 | maksimlekler | 1 |
| (CLOSED) CC | 01/05/12 | 01/07/12 | obson | 0 |
| (CLOSED) CD44 protein | 08/14/10 | 08/24/10 | mikedressner | 1 |
| (CLOSED) Chem 1307 Spring 2011 Contest | 03/09/11 | 03/31/11 | brian.parker | 13 |
| (CLOSED) CHEM 1460 Puzzle | 02/04/11 | 02/12/11 | ltchong | 1 |
| (CLOSED) CHEM 1460 Puzzle 2 | 02/04/11 | 02/11/11 | ltchong | 1 |
| (CLOSED) Chem 2225 Spring 2011 Contest | 03/09/11 | 03/31/11 | brian.parker | 7 |
| (CLOSED) Chem 431 contest | 08/24/11 | 09/19/11 | laurabee | 28 |
| (CLOSED) chemchem111 | 02/01/12 | 02/02/12 | nlite510 | 1 |
| Chicken Noodle Soup | 02/17/13 | 06/22/13 | mattymoe | 1 |
| (CLOSED) clamp test | 03/30/12 | 03/31/12 | hilaryar | 1 |
| (CLOSED) Clayton Biochemistry Fall 12 | 09/30/12 | 12/01/12 | rsingiser | 17 |
| (CLOSED) Clayton Biochemistry Spring 13 | 02/25/13 | 05/05/13 | rsingiser | 25 |
| (CLOSED) CLEAN ME!!!!!!!!!!!!!!!!! | 02/17/12 | 02/18/12 | Bjamin | 1 |
| (CLOSED) ClpB | 10/09/11 | 10/28/12 | kevinjh | 1 |
| (CLOSED) Common Immunogenic Substrate (Fragment) | 05/23/12 | 06/30/12 | scooper14 | 3 |
| (CLOSED) Compbio | 08/22/11 | 08/23/11 | hahnbeom | 5 |
| (CLOSED) Compbio2 | 08/22/11 | 08/23/11 | hahnbeom | 5 |
| (CLOSED) Compbio3 | 08/22/11 | 08/23/11 | hahnbeom | 5 |
| (CLOSED) Compbio4 | 08/22/11 | 08/23/11 | hahnbeom | 5 |
| (CLOSED) contest | 09/27/11 | 12/25/11 | meganium214 | 0 |
| (CLOSED) contest | 09/27/11 | 12/25/11 | meganium214 | 0 |
| (CLOSED) Contest | 03/16/13 | 03/31/13 | dallinac | 0 |
| (CLOSED) Contest | 03/17/13 | 03/18/13 | CardsOverCoins | 1 |
| (CLOSED) contest | 04/22/12 | 04/24/12 | yesir | 2 |
| (CLOSED) contest | 06/26/11 | 07/13/11 | madpenguin | 2 |
| (CLOSED) contest | 03/19/11 | 05/22/11 | protein123 | 1 |
| (CLOSED) Contest | 07/30/12 | 07/31/12 | Nicbudd77 | 0 |
| (CLOSED) contest de foldit | 05/15/12 | 05/18/12 | Alakazam Einstein | 2 |
| (CLOSED) Contest name goes here? | 08/02/10 | 08/05/10 | oakwhiz | 1 |
| (CLOSED) Contest Template Test | 01/02/11 | 01/01/12 | maksimlekler | 1 |
| (CLOSED) Contest10000G1 | 09/14/10 | 10/01/10 | crispy fry | 1 |
| (CLOSED) coolkids2 contest | 07/06/12 | 07/07/12 | jedsbro45 | 1 |
| (CLOSED) coolkids2 contest | 07/06/12 | 07/07/12 | jedsbro45 | 0 |
| (CLOSED) CRAC | 01/31/12 | 02/23/12 | testdudetest | 1 |
| (CLOSED) Crashguard303 Script test | 06/07/10 | 06/14/10 | Crashguard303 | 3 |
| (CLOSED) CRAZY | 03/12/11 | 03/17/11 | alex2011 | 1 |
| (CLOSED) CURE CANCER win | 09/24/11 | 09/25/12 | Ross3 | 1 |
| cyrusi's challange | 02/17/12 | 01/01/15 | cyrusi | 0 |
| d o | 08/23/12 | 08/23/15 | Joanna Staite | 0 |
| (CLOSED) Daddy's | 11/30/10 | 12/25/10 | TheDaddyTired | 0 |
| (CLOSED) Dana_Nicolo | 04/17/12 | 04/18/12 | dananumber13 | 3 |
| (CLOSED) DcmB | 04/18/12 | 07/13/12 | shadowwalk | 0 |
| (CLOSED) Degradation of Wood! Lets understand methane and CO2 production! | 01/21/12 | 09/30/12 | losWEEDos | 1 |
| (CLOSED) Dengue Virus NS3 protease domain | 09/26/11 | 10/31/11 | Neffets | 1 |
| design | 11/22/12 | 12/31/13 | smart guy | 0 |
| (CLOSED) Design 40 | 11/17/12 | 12/17/12 | clptrsn | 1 |
| (CLOSED) Design a protein | 11/18/10 | 12/18/10 | svenskhan | 1 |
| Design it | 06/15/12 | 06/21/14 | DustWitch | 1 |
| Design Space | 06/15/12 | 06/21/14 | drummerdude204 | 22 |
| design your own protein | 02/13/12 | 02/14/14 | mberna00 | 1 |
| dhtrjkg vbuibmjjmknv n bogf bjh mknkn | 05/18/11 | 05/19/14 | oxyi | 1 |
| dhtrjkg vbuibmjjmknv n bogf bjh mknkn | 05/18/11 | 05/19/14 | oxyi | 1 |
| (CLOSED) dhtrjkg vbuibmjjmknv n bogf bjh mknknb | 05/18/11 | 05/19/11 | oxyi | 1 |
| (CLOSED) Dj-P's duel puzzle | 02/17/11 | 02/18/11 | Dj-P | 1 |
| (CLOSED) Dog tests himself | 11/07/11 | 11/08/11 | est000dog | 1 |
| (CLOSED) dont worry | 03/24/12 | 03/29/12 | billyhuegel | 0 |
| (CLOSED) DR.B JWU BIOCHEM | 12/19/12 | 02/10/13 | drmbudziszek | 0 |
| (CLOSED) DR.B JWU BIOCHEM Contest-HIV protease | 01/08/13 | 02/17/13 | drmbudziszek | 7 |
| Drosophila Melanogaster nmd protein AAA superfamily | 02/09/13 | 02/08/14 | jjwinkle4740 | 1 |
| (CLOSED) DSSP algorithm vs NR data base | 05/29/12 | 06/29/12 | BitSpawn | 6 |
| (CLOSED) Dubons Class Contest | 09/08/10 | 09/10/10 | dubon1 | 2 |
| (CLOSED) Easy Contest | 12/12/12 | 12/30/12 | haywick | 0 |
| (CLOSED) Easy first alignment | 05/09/11 | 05/31/11 | serico7 | 1 |
| easy!!!! :o) | 10/01/10 | 12/31/13 | yomama | 0 |
| (CLOSED) Educurious Frizzled Design Puzzle Contest! | 02/10/13 | 03/31/13 | katievh | 51 |
| (CLOSED) efeli | 10/11/11 | 10/12/11 | chatask | 1 |
| (CLOSED) EL3 #2 | 03/01/13 | 05/03/13 | Wilm | 0 |
| (CLOSED) Elijahs contest | 03/08/13 | 03/31/13 | ilikediamonds | 2 |
| Entamoeba insertion domain | 10/06/12 | 10/12/13 | lucnoken | 1 |
| (CLOSED) erero7 challenge | 02/08/12 | 02/29/12 | erero7 | 0 |
| (CLOSED) erero7 challenge | 02/08/12 | 02/29/12 | erero7 | 0 |
| (CLOSED) erero7 challenge | 02/08/12 | 02/29/12 | erero7 | 0 |
| (CLOSED) erero7 challenge | 02/08/12 | 02/29/12 | erero7 | 1 |
| etrg | 03/26/11 | 12/31/14 | oxyi | 0 |
| etrg | 03/26/11 | 12/31/14 | oxyi | 0 |
| etrg | 03/26/11 | 12/31/14 | oxyi | 0 |
| (CLOSED) evaesion | 12/28/12 | 12/31/12 | Evaesion | 0 |
| (CLOSED) Even simpler recipe tester | 05/31/10 | 06/30/10 | Datstandin | 1 |
| (CLOSED) Everyone can join | 12/03/12 | 01/16/13 | junikl2 | 1 |
| Everyone Join! | 06/28/12 | 12/24/13 | lakeyja900 | 62 |
| (CLOSED) extended_design_tj | 08/02/12 | 08/05/12 | TJBrunette | 1 |
| (CLOSED) F20 for testing | 12/24/10 | 02/28/11 | Rav3n_pl | 8 |
| (CLOSED) Facile for Italian :) | 09/24/11 | 10/24/11 | Vaio | 1 |
| (CLOSED) fahdkabani | 02/20/13 | 02/21/13 | fahdkabani | 2 |
| Family and Friends | 05/13/13 | 05/07/16 | LunarEclipse | 1 |
| (CLOSED) FANTASY | 01/09/12 | 01/10/12 | hu74go | 1 |
| (CLOSED) Fastest person | 12/13/12 | 12/22/12 | ponies_rock | 1 |
| fbdfnbdgn | 05/23/11 | 12/31/14 | oxyi | 1 |
| feqf | 01/21/13 | 01/17/15 | jinguluninja | 1 |
| ferer gerge | 01/27/13 | 01/13/16 | jinguluninja | 1 |
| (CLOSED) find the various aminos | 07/06/10 | 12/31/10 | smith92clone | 2 |
| (CLOSED) fire and rain | 11/20/12 | 12/22/12 | mattymoe | 1 |
| (CLOSED) fire and rain | 11/20/12 | 12/22/12 | mattymoe | 1 |
| (CLOSED) first | 02/20/11 | 12/31/11 | jojotastic777 | 1 |
| (CLOSED) first | 02/25/11 | 12/31/11 | alex2011 | 1 |
| (CLOSED) first contest | 10/20/11 | 10/21/11 | Robinso | 1 |
| (CLOSED) First molecule | 04/12/13 | 04/13/13 | gsandoval | 1 |
| (CLOSED) first time | 03/24/12 | 03/25/12 | billyhuegel | 1 |
| (CLOSED) Flu Puzzle | 10/09/12 | 10/11/12 | beta_helix | 3 |
| (CLOSED) Flu Puzzle Competition | 10/09/12 | 10/11/12 | beta_helix | 28 |
| (CLOSED) Foamy Virus Gag protein | 04/10/12 | 04/17/12 | blutjoghurt | 1 |
| (CLOSED) FOLD Championship | 12/23/10 | 12/31/10 | Dj-P | 1 |
| (CLOSED) Fold It (or else) | 09/20/10 | 09/26/10 | Zeff | 0 |
| (CLOSED) Fold It (or else) | 09/20/10 | 09/26/10 | Zeff | 0 |
| (CLOSED) fold it contest | 11/29/12 | 11/30/12 | ylecroy | 2 |
| (CLOSED) Foldit University Challenge | 11/05/10 | 11/19/10 | ilya.makedon | 47 |
| (CLOSED) For my students | 03/16/12 | 03/23/12 | GirichMS | 1 |
| (CLOSED) For stud. 2 | 03/18/12 | 04/30/12 | GirichMS | 1 |
| (CLOSED) For stud. 3 | 03/18/12 | 04/30/12 | GirichMS | 1 |
| (CLOSED) For students | 03/18/12 | 04/30/12 | GirichMS | 1 |
| (CLOSED) For testing purposes | 03/19/13 | 03/31/13 | f00barbob | 1 |
| (CLOSED) Free Challenge for University Students | 11/18/10 | 12/18/10 | ilya.makedon | 0 |
| (CLOSED) free style 500 | 09/20/10 | 10/31/10 | ethanIc | 1 |
| (CLOSED) Freebuild | 07/18/11 | 07/20/11 | e-wok456 | 1 |
| (CLOSED) freebuild2 | 07/18/11 | 07/20/11 | e-wok456 | 1 |
| (CLOSED) Freedom | 01/07/12 | 01/09/12 | qbolt500 | 0 |
| (CLOSED) Freestyle | 08/16/12 | 08/30/12 | Mytherus | 1 |
| Freestyle | 10/08/12 | 10/07/13 | asdf9 | 5 |
| (CLOSED) Freestyle | 09/21/11 | 09/29/11 | Stano28 | 0 |
| (CLOSED) Freestyle 20 | 03/17/12 | 03/20/12 | upquark | 1 |
| (CLOSED) Freestyle 80 for a month | 06/25/10 | 07/31/10 | sehskyle | 1 |
| (CLOSED) Freestyle 80 segment de-novo | 04/22/13 | 04/27/13 | wosser1 | 1 |
| (CLOSED) Freestyle Competition | 07/19/11 | 07/26/11 | rattlesnake8 | 0 |
| (CLOSED) Freestyle Design | 12/24/11 | 12/31/11 | r4m3nn00dl3s | 0 |
| Freestyle Design | 04/22/12 | 04/30/14 | michaeled314 | 1 |
| Freestyle Design (80 segments) | 01/13/13 | 01/31/14 | OrigamiMaster | 1 |
| (CLOSED) Freestyle Design - 20 (ST - Recipe Research Channel) | 06/18/11 | 06/30/11 | Seagat2011 | 1 |
| (CLOSED) Freestyle Design - 80 (Anthropic Dreams team members) | 06/17/11 | 06/22/11 | Seagat2011 | 4 |
| Freestyle design 20 | 10/09/12 | 10/09/14 | meatexplosion | 1 |
| Freestyle design 40 | 10/09/12 | 10/09/14 | meatexplosion | 1 |
| Freestyle Design 40: For Learning LUA | 06/24/12 | 06/30/15 | gitwut.lua | 1 |
| (CLOSED) Freestyle Design 500 | 04/28/11 | 05/31/11 | Acida-2 | 4 |
| (CLOSED) Freestyle Design 500 | 12/09/10 | 12/12/10 | MHannigan | 1 |
| (CLOSED) Freestyle Design 500 | 11/21/12 | 11/22/12 | Daileyc | 0 |
| (CLOSED) Freestyle Design 500 | 10/16/11 | 11/06/11 | ofc2000 | 1 |
| (CLOSED) Freestyle Design 500 | 04/16/12 | 04/29/12 | drumpeter18yrs9yrs | 2 |
| (CLOSED) Freestyle Design 80 | 05/03/13 | 05/18/13 | iqbalmahmud | 1 |
| (CLOSED) Freestyle Design 80 | 10/17/10 | 10/01/11 | BlueRabit | 1 |
| (CLOSED) Freestyle Design 80 | 04/13/13 | 04/20/13 | JamesLeCornu | 0 |
| (CLOSED) Freestyle Design 80 | 08/21/10 | 10/31/10 | Handful | 1 |
| (CLOSED) Freestyle Design 80 | 01/31/12 | 02/09/12 | kimdn | 1 |
| (CLOSED) Freestyle Design 80 | 03/24/12 | 09/30/12 | ofc2000 | 1 |
| (CLOSED) Freestyle Design Competition | 06/20/11 | 06/30/11 | Dinoclor | 1 |
| (CLOSED) Freestyle Design this 500 residue protein - Seagat2011 | 12/17/10 | 01/14/12 | Seagat2011 | 50 |
| (CLOSED) Freestyle Design Variable Length | 01/09/11 | 01/01/12 | ten04031977 | 1 |
| (CLOSED) Freestyle Design Variable Length. 2 weeks | 04/09/13 | 04/24/13 | MurloW | 1 |
| (CLOSED) Freestyle Design: Variable Length | 05/02/13 | 05/10/13 | ligandfinder | 1 |
| (CLOSED) Freestyle Design: Variable Length | 04/28/11 | 05/31/11 | Acida-2 | 1 |
| (CLOSED) Freestyle for all | 11/01/10 | 12/05/10 | thosi | 3 |
| (CLOSED) freestyle fun | 09/26/12 | 12/31/12 | saggyballs | 1 |
| (CLOSED) Freestyle Multi-start 499.9 | 12/22/10 | 01/01/11 | Dj-P | 1 |
| Freestyle Simple | 08/19/11 | 08/21/14 | WheelerLovett | 0 |
| Freestyle Simple | 08/19/11 | 08/21/14 | WheelerLovett | 1 |
| (CLOSED) freestyle test | 10/27/12 | 10/28/12 | Marek_Berlin | 1 |
| (CLOSED) Freestyle Variable Length. 1 month. | 02/26/13 | 03/25/13 | MurloW | 8 |
| (CLOSED) Freestyle!!! | 01/11/12 | 01/12/12 | adele21 | 0 |
| FreestyleBKG | 12/22/10 | 12/31/13 | aricc | 1 |
| (CLOSED) Frizzle | 12/02/12 | 03/02/13 | marie_s | 1 |
| (CLOSED) Frizzled | 03/21/13 | 03/23/13 | beta_helix | 1 |
| (CLOSED) Frizzled Design because we are bored | 01/24/13 | 01/27/13 | jamiexq | 17 |
| (CLOSED) Frizzled Design Puzzle Contest - October PD | 10/25/12 | 11/01/12 | katievh | 1 |
| FTN1438 | 12/19/12 | 12/31/13 | nwabu1ao | 1 |
| (CLOSED) Fun | 12/12/10 | 12/31/10 | bost29 | 1 |
| FUN! FUN! | 11/17/12 | 11/30/15 | alexkarate | 0 |
| (CLOSED) GFP | 10/18/10 | 10/30/10 | Pyrohmstr | 1 |
| (CLOSED) GFP | 10/18/10 | 10/30/10 | Pyrohmstr | 0 |
| (CLOSED) GFP1 | 10/18/10 | 10/30/10 | Pyrohmstr | 1 |
| (CLOSED) Giordano's Class | 09/09/10 | 09/13/10 | cgiordano | 0 |
| (CLOSED) Go freestyle! | 04/15/12 | 04/22/12 | AsDawnBreaks | 1 |
| (CLOSED) go with the flow | 12/23/12 | 12/30/12 | Npereira | 1 |
| (CLOSED) Go with the flow 2 | 12/23/12 | 12/30/12 | Npereira | 1 |
| (CLOSED) god berry | 02/18/11 | 03/12/11 | My Cranky Panda | 1 |
| (CLOSED) good luck | 03/24/12 | 03/25/12 | billyhuegel | 1 |
| (CLOSED) Governors Academy Freestylin' | 12/02/11 | 12/04/11 | conorodea111 | 1 |
| (CLOSED) GOVST BIOCHEMISTRY | 05/07/12 | 12/17/12 | govstbiochem | 1 |
| (CLOSED) Grand master rival challenge | 01/01/11 | 12/31/11 | Malzarg | 0 |
| (CLOSED) GTPase | 07/11/10 | 08/31/10 | Jordandk | 1 |
| (CLOSED) GTPase pas puzzle | 09/14/12 | 12/31/12 | SOARcdur | 1 |
| (CLOSED) GTPase Ras | 09/23/11 | 10/07/11 | Miah | 2 |
| GTPase Ras | 05/15/13 | 05/31/13 | Ninty9 | 0 |
| (CLOSED) GTPase Ras | 08/18/10 | 08/31/10 | harlexander | 1 |
| (CLOSED) GTPase Ras | 09/10/11 | 09/01/12 | glenwayguy | 1 |
| (CLOSED) GTPase Ras | 10/19/11 | 03/18/12 | wangyueyun | 1 |
| (CLOSED) GTPase Ras | 11/23/12 | 12/28/12 | ridesisapis | 0 |
| (CLOSED) GTPase Ras | 11/25/11 | 12/31/11 | O Seki To | 0 |
| gtpase ras | 02/09/13 | 02/01/15 | jjwinkle4740 | 1 |
| (CLOSED) GTPase Ras 1.0 | 12/23/10 | 12/31/10 | Dj-P | 1 |
| GTPase Ras long run *Anyone can join!* | 11/25/12 | 12/31/15 | AsDawnBreaks | 48 |
| (CLOSED) GTPase Ras test | 02/29/12 | 04/30/12 | oshirikajirimushi18th | 1 |
| (CLOSED) H3 Hemagglutinin Flu Design Puzzle | 02/01/12 | 02/03/12 | beta_helix | 4 |
| (CLOSED) hahhaaha cool. | 11/19/12 | 11/23/12 | joshlitchman | 1 |
| (CLOSED) Halobacterium NRC-1 Hypothetical Protein | 01/08/11 | 05/31/11 | pramodbhat | 1 |
| (CLOSED) Halorhodopsin | 02/18/12 | 02/26/12 | MnSOD | 0 |
| (CLOSED) HansDampf | 02/28/13 | 05/03/13 | Wilm | 0 |
| (CLOSED) hard | 11/13/10 | 12/31/10 | marshin | 1 |
| (CLOSED) HBV core protein | 03/14/13 | 03/15/13 | Tsogo | 0 |
| (CLOSED) HBV core protein | 03/14/13 | 03/23/13 | Tsogo | 1 |
| (CLOSED) hemoglobin check | 11/26/11 | 11/30/11 | Rellis | 1 |
| (CLOSED) Hexaguin's Freestyle 80 | 01/22/12 | 01/31/12 | hexaguin | 1 |
| (CLOSED) hi | 02/17/12 | 02/29/12 | cyrusi | 1 |
| (CLOSED) hi2 | 02/18/12 | 03/01/12 | cyrusi | 1 |
| (CLOSED) Histone H1 | 01/03/11 | 01/31/11 | Dj-P | 4 |
| (CLOSED) HIV | 01/07/12 | 02/11/12 | fallenspartan | 1 |
| (CLOSED) HIV | 12/20/11 | 01/31/12 | Chappers | 7 |
| (CLOSED) hiv | 11/12/10 | 01/16/11 | marshin | 1 |
| (CLOSED) HIV | 12/05/12 | 12/29/12 | Quxwozing | 1 |
| (CLOSED) HIV Crash test | 12/21/10 | 12/31/11 | Dr Tyrell | 1 |
| (CLOSED) HIV attack | 06/05/11 | 06/30/12 | Overlord13 | 1 |
| (CLOSED) HIV challenge | 10/09/11 | 10/30/11 | ofc2000 | 0 |
| (CLOSED) HIV fight! | 08/22/10 | 08/31/10 | Rav3n_pl | 29 |
| (CLOSED) HIV Protease | 03/05/12 | 03/01/13 | dbuske | 1 |
| (CLOSED) HIV protease | 09/17/10 | 09/18/10 | skoddet1 | 20 |
| (CLOSED) HIV protease | 01/16/12 | 01/17/12 | recondite7 | 0 |
| (CLOSED) HIV protease | 01/16/12 | 01/20/12 | recondite7 | 2 |
| (CLOSED) HIV protease | 03/05/13 | 03/26/13 | alex809010 | 0 |
| (CLOSED) HIV protease | 07/09/12 | 07/31/12 | drumpeter18yrs9yrs | 0 |
| (CLOSED) hiv protease | 07/11/10 | 07/17/10 | asianboy26 | 1 |
| (CLOSED) HIV Protease | 01/21/12 | 03/03/12 | recondite7 | 159 |
| (CLOSED) HIV protease | 10/17/11 | 10/22/11 | Joshua Algode | 1 |
| (CLOSED) HIV protease | 01/02/11 | 01/01/12 | maksimlekler | 1 |
| (CLOSED) HIV protease | 01/25/12 | 01/31/12 | docfon | 1 |
| (CLOSED) hiv protease | 10/19/11 | 10/19/12 | jerrywhite13 | 1 |
| HIV protease | 01/09/11 | 12/31/14 | Alegend45 | 1 |
| (CLOSED) HIV protease - BIOL225 | 01/16/13 | 01/22/13 | Kimbostu | 10 |
| (CLOSED) HIV protease contest! | 05/29/11 | 05/31/11 | chouti | 1 |
| (CLOSED) HIV protease new | 09/29/11 | 10/31/11 | davidpat | 1 |
| HIV protease sandbox | 05/04/11 | 05/01/14 | tyler0911 | 32 |
| (CLOSED) HIV protease test | 03/01/12 | 05/01/12 | oshirikajirimushi18th | 1 |
| HIV stinks.... yeah yeah | 05/12/12 | 05/01/14 | tweak64 | 1 |
| (CLOSED) HIV test | 04/11/12 | 04/13/12 | SciShowFTW | 1 |
| (CLOSED) HiV try | 08/20/10 | 09/20/10 | Pyotr | 1 |
| HIV's end | 02/13/11 | 12/31/14 | Dj-P | 155 |
| (CLOSED) hjjjjjjjjjjjjjjjjjj | 12/20/11 | 12/31/14 | oxyi | 1 |
| (CLOSED) hm | 04/07/13 | 04/09/13 | MurloW | 1 |
| (CLOSED) hmm | 04/07/13 | 04/09/13 | MurloW | 1 |
| hnvfcfhncfh kbkkkh | 06/15/11 | 12/31/14 | oxyi | 1 |
| (CLOSED) Holotoxin | 02/03/12 | 02/06/12 | Erik.dover | 0 |
| (CLOSED) Homology Modeling Course: HIV Protease | 06/12/12 | 06/15/12 | obiwan | 7 |
| (CLOSED) Homology_Praktikum_IBK_SS11 | 06/16/11 | 06/20/11 | csac1959 | 9 |
| (CLOSED) hotu | 11/12/10 | 11/30/10 | marshin | 1 |
| (CLOSED) Human Respiratory Syncytial Virus Attachment Protein (RSV G) | 04/12/12 | 07/31/12 | MiCu | 1 |
| intracellular Caspase-Modulating Chimeric Antigen Receptor | 07/17/12 | 07/17/14 | starone | 0 |
| (CLOSED) ISHMIT DAHAL | 03/18/13 | 03/19/13 | USER2013 | 1 |
| (CLOSED) j | 09/30/11 | 10/01/11 | klixovann | 0 |
| (CLOSED) JJJP bmi206 fold | 11/07/11 | 11/30/11 | Peter2000 | 0 |
| (CLOSED) jnkljnklhjnljnljnl | 12/04/11 | 12/31/11 | oxyi | 1 |
| (CLOSED) jnkljnklhjnljnljnl | 12/04/11 | 12/31/11 | oxyi | 0 |
| Join if u Dare | 04/26/13 | 04/20/14 | srgp2012 | 5 |
| jujujujujujujujujujujujujuj ujujujujujujujujujujujujujujujujujujujujujujuju | 12/24/11 | 12/31/14 | oxyi | 1 |
| (CLOSED) Just 4 fun | 07/12/12 | 07/20/12 | Josephdud66 | 1 |
| (CLOSED) just do it | 10/30/11 | 12/31/11 | pokemon.guy | 0 |
| (CLOSED) Just For Fun | 01/26/12 | 01/27/12 | Metadryad | 1 |
| (CLOSED) Just for test | 09/06/12 | 09/07/12 | dyh | 1 |
| (CLOSED) Just playing around | 03/13/12 | 03/20/12 | wdherndon | 1 |
| (CLOSED) kanya | 10/14/10 | 10/26/10 | g5314401673 | 1 |
| (CLOSED) Kenny | 10/26/12 | 01/01/13 | kennyhill | 0 |
| (CLOSED) khc head | 04/13/11 | 04/20/13 | ceventer | 0 |
| (CLOSED) khc test | 10/14/10 | 10/14/11 | ceventer | 1 |
| (CLOSED) khfchlk 1 | 02/23/12 | 02/24/12 | Solenopsis invicta | 1 |
| (CLOSED) kk's contest | 04/20/11 | 04/30/11 | kkwizard101 | 1 |
| (CLOSED) Knotfind on | 12/10/11 | 12/31/11 | beta_helix | 6 |
| (CLOSED) Knots | 05/22/12 | 05/23/12 | AsDawnBreaks | 1 |
| Kumamolisin | 06/13/12 | 07/31/15 | drummerdude204 | 1 |
| (CLOSED) l2pmike | 09/24/12 | 09/25/12 | OppaProteinStyleZ | 0 |
| (CLOSED) l2pmike | 09/24/12 | 09/25/12 | OppaProteinStyleZ | 0 |
| (CLOSED) Laccase | 01/19/11 | 01/23/11 | El_Crazy_Xabi | 1 |
| (CLOSED) Large Protein Test | 12/14/10 | 12/15/10 | Gray Thomas | 1 |
| (CLOSED) LASA Octagon | 02/07/13 | 02/10/13 | JosephOleniczak | 0 |
| Lastest contest against the cancer | 03/30/12 | 12/31/15 | Dj-P | 18 |
| (CLOSED) laura test | 08/23/11 | 08/24/11 | laurabee | 1 |
| (CLOSED) laura test2 | 08/23/11 | 08/24/11 | laurabee | 1 |
| (CLOSED) Laurabee's puzzle | 07/13/11 | 07/14/11 | laurabee | 0 |
| Let's Cure Cancer Finally | 08/18/10 | 12/31/13 | mikedressner | 575 |
| (CLOSED) Let's go!!!! | 04/28/12 | 12/12/12 | wendy_rupnow | 0 |
| (CLOSED) Let's go!!!! | 04/28/12 | 12/12/12 | wendy_rupnow | 0 |
| (CLOSED) Let's have fun. | 07/25/11 | 08/02/11 | etety33 | 1 |
| (CLOSED) LETSGO | 08/26/11 | 08/27/11 | wudoo | 4 |
| (CLOSED) leukaemia virus chain native matrix | 02/01/12 | 08/27/12 | GoshaDole | 1 |
| (CLOSED) ligan practice -open to all | 03/21/12 | 03/31/12 | Mike Tate | 3 |
| (CLOSED) Ligand Folding Practice- Open to all | 05/01/11 | 09/01/11 | tyler0911 | 23 |
| (CLOSED) Ligand Practice | 05/24/11 | 09/11/11 | tyler0911 | 3 |
| (CLOSED) lms friends | 12/03/12 | 12/04/12 | johncb3 | 0 |
| (CLOSED) Long Contest | 09/20/10 | 01/01/12 | maquiladora | 1 |
| (CLOSED) Long links | 04/21/12 | 04/30/12 | AsDawnBreaks | 6 |
| (CLOSED) Loss Cancer | 08/31/10 | 12/31/10 | FalconDeOro | 1 |
| (CLOSED) love vs. love | 02/22/12 | 02/24/12 | k.love | 2 |
| (CLOSED) LPDF Contest | 04/30/12 | 05/03/12 | maxionwimps | 1 |
| (CLOSED) LUA test | 01/05/11 | 01/30/11 | Dj-P | 1 |
| (CLOSED) lv.1 | 03/28/11 | 04/03/11 | Marco Chan | 1 |
| M | 07/05/10 | 07/31/13 | RoboMonkey | 1 |
| m,jb ghj | 06/15/11 | 12/31/14 | oxyi | 0 |
| m,jb ghj | 06/15/11 | 12/31/14 | oxyi | 1 |
| (CLOSED) Mad hatter | 01/17/13 | 01/18/13 | EmperorSupreme | 0 |
| (CLOSED) Malaria Puzzle | 10/09/12 | 10/11/12 | beta_helix | 3 |
| (CLOSED) Marcus | 05/17/12 | 05/20/12 | mdaquino | 1 |
| (CLOSED) marolidas sandbox | 11/20/12 | 11/27/12 | marolidas | 1 |
| (CLOSED) Mat test | 03/20/12 | 03/20/13 | mat747 | 1 |
| (CLOSED) math modeling | 07/16/10 | 07/29/12 | themarquis | 1 |
| MediumFREE STYLE | 08/23/11 | 08/31/14 | WheelerLovett | 0 |
| MediumFREE STYLE | 08/23/11 | 08/31/14 | WheelerLovett | 1 |
| (CLOSED) meh | 10/17/10 | 10/31/10 | anthunk | 1 |
| (CLOSED) Membrane receptor | 12/20/12 | 02/28/13 | ScottNDean | 1 |
| (CLOSED) Metallothionein | 11/05/12 | 11/30/12 | Phil.Pa | 1 |
| (CLOSED) Michael and Marco | 10/05/11 | 10/06/11 | bigbanggd410 | 0 |
| (CLOSED) Michael and Marco | 10/05/11 | 10/06/11 | bigbanggd410 | 0 |
| (CLOSED) Michael and Marco | 10/05/11 | 10/06/11 | bigbanggd410 | 2 |
| (CLOSED) mine silly | 01/17/11 | 12/31/11 | anthunk | 1 |
| (CLOSED) Moar Freestyle Design. 80 seg, 1 week | 03/26/13 | 04/02/13 | MurloW | 2 |
| (CLOSED) Moloney Murine Leukaemia Virus Matrix Protein | 02/14/12 | 05/15/12 | Ch Garnier | 29 |
| (CLOSED) Moloney Murine Leukaemia Virus Matrix Protein | 02/01/12 | 02/03/12 | beta_helix | 4 |
| (CLOSED) Monkeys Rock Ham jhhh hhhhhhhhh | 12/04/12 | 12/30/12 | NathanGotSkills23 | 0 |
| (CLOSED) Monooxygenase | 03/10/12 | 04/30/12 | hansfoldit | 0 |
| (CLOSED) Montcrest | 12/20/11 | 01/31/12 | Chappers | 3 |
| (CLOSED) Montcrest | 12/20/11 | 01/31/12 | Chappers | 1 |
| (CLOSED) Montcrest for real | 12/20/11 | 01/31/12 | Chappers | 1 |
| more testing | 05/04/11 | 12/31/14 | anthunk | 1 |
| (CLOSED) more thunk testing | 03/29/12 | 06/30/12 | anthunk | 9 |
| (CLOSED) motor protein tail | 08/23/10 | 08/23/11 | ceventer | 1 |
| Mr Ma No. One | 07/29/11 | 07/29/14 | mayumiao | 1 |
| (CLOSED) Mr Ma No.1 | 07/27/11 | 07/31/12 | mayumiao | 1 |
| (CLOSED) MRMAND123 | 11/09/11 | 11/09/12 | MR MAN D | 1 |
| Multi-domain protein | 04/10/13 | 07/10/13 | pbartlow | 1 |
| (CLOSED) Multi-histidine and Glutamate sequence complexed with Mn(II) | 09/26/11 | 10/10/11 | masspeana | 1 |
| (CLOSED) Multi-Start Bacteroides Vulgatus Contest | 10/13/12 | 04/13/13 | Ch Garnier | 17 |
| (CLOSED) mva1alpha | 09/22/10 | 09/21/11 | mvackel | 1 |
| (CLOSED) my contest | 09/20/11 | 12/20/11 | Lysergic cure | 1 |
| (CLOSED) my contest | 09/01/10 | 09/02/10 | marissa101 | 0 |
| (CLOSED) My first contest | 09/14/12 | 09/30/12 | SOARcdur | 1 |
| (CLOSED) My first contest | 10/26/11 | 10/31/11 | awesome4132 | 1 |
| (CLOSED) my freestyle trial | 12/20/11 | 12/27/11 | Niubilism | 1 |
| (CLOSED) my own | 05/06/13 | 05/07/13 | silverberg | 1 |
| (CLOSED) myoglobin | 01/22/12 | 01/26/12 | vacmar | 1 |
| (CLOSED) Myoglobin | 11/30/11 | 12/23/11 | Ronald Wichman | 0 |
| (CLOSED) N-GlnR | 06/09/12 | 09/30/12 | weihuachen5211 | 1 |
| (CLOSED) Nanog Homeobox Protein (NANOG) | 03/07/12 | 03/07/13 | Ch Garnier | 34 |
| (CLOSED) Need structure | 09/29/10 | 10/10/10 | canikickit49 | 1 |
| (CLOSED) New small test | 06/17/10 | 07/30/10 | Crashguard303 | 4 |
| (CLOSED) niep | 10/24/10 | 10/26/10 | niep0329 | 1 |
| nmd AAA ATPase | 02/09/13 | 02/08/14 | jjwinkle4740 | 2 |
| (CLOSED) No Peeking - Immediately drag puzzle off screen when beginning. Players should NEVER see the protein. | 06/01/12 | 06/30/12 | phi16 | 46 |
| (CLOSED) No. 4. | 03/18/12 | 04/30/12 | GirichMS | 1 |
| (CLOSED) No. 5 | 03/18/12 | 04/30/12 | GirichMS | 1 |
| (CLOSED) No. 6 | 03/18/12 | 04/30/12 | GirichMS | 1 |
| (CLOSED) ofc2000's tough challenge (open) | 10/29/11 | 10/31/11 | ofc2000 | 1 |
| (CLOSED) One day challenge | 11/04/11 | 11/05/11 | scienceschmoo | 0 |
| (CLOSED) One day challenge | 11/04/11 | 11/05/11 | scienceschmoo | 1 |
| (CLOSED) One last CASP9 Target! | 08/25/10 | 09/28/10 | beta_helix | 74 |
| Open 500 Segment design puzzle | 09/09/12 | 12/31/15 | Ryanfav | 15 |
| (CLOSED) Open University Challenge | 11/20/10 | 12/18/10 | ilya.makedon | 2 |
| Other receptor | 12/20/12 | 12/14/13 | ScottNDean | 1 |
| (CLOSED) P1a1b | 10/22/10 | 10/21/11 | mvackel | 1 |
| (CLOSED) P22-N | 04/23/13 | 04/27/13 | syoifczeri | 1 |
| (CLOSED) P22-N^W[Tb] | 04/23/13 | 04/30/13 | syoifczeri | 1 |
| (CLOSED) PA1955_Repeat | 11/10/11 | 12/23/11 | MadsTS | 1 |
| (CLOSED) Pace Academy Freestyle Design 80 | 08/24/12 | 09/30/12 | thattori | 1 |
| (CLOSED) Pass the Thyme | 01/09/11 | 02/28/11 | TheGUmmer | 1 |
| (CLOSED) PdB24 | 11/05/10 | 02/01/11 | PdB24 | 0 |
| (CLOSED) PdB24 | 11/05/10 | 02/01/11 | PdB24 | 1 |
| pechi demo | 03/03/13 | 06/07/13 | anthunk | 2 |
| (CLOSED) Pedobacter Beta Barrel | 12/14/10 | 12/25/10 | Gray Thomas | 1 |
| (CLOSED) Penn State Hershey BMS 504 | 10/15/12 | 10/28/12 | iropson | 1 |
| (CLOSED) Penn State Hershey BMS 504 Contest 2 | 10/15/12 | 10/28/12 | iropson | 27 |
| (CLOSED) peptide test | 05/31/13 | 05/17/14 | syoifczeri | 1 |
| (CLOSED) PFV Gag | 04/17/12 | 07/17/12 | blutjoghurt | 1 |
| (CLOSED) PhAlpha1Beta | 09/12/10 | 09/13/10 | mvackel | 1 |
| (CLOSED) PhAlpha1Beta | 09/12/10 | 09/15/10 | mvackel | 1 |
| (CLOSED) Phalpha1beta | 08/14/10 | 08/15/10 | mvackel | 1 |
| (CLOSED) phospholipase A2 from mamushi snake venom | 01/11/12 | 01/26/12 | gurimmer | 0 |
| (CLOSED) PODXL | 08/04/11 | 08/26/11 | machoo | 1 |
| (CLOSED) Polish Contest | 11/20/11 | 12/20/11 | Mojzesz | 4 |
| (CLOSED) Pregnancy Associated Plasma Protein (PAPP-A) | 03/12/11 | 08/15/11 | meschruhms | 1 |
| (CLOSED) Protein Contest | 04/25/12 | 12/31/12 | Dave Levine | 0 |
| (CLOSED) protein to test scripts | 05/22/10 | 12/31/10 | smith92clone | 1 |
| (CLOSED) prova | 01/08/12 | 01/17/12 | hu74go | 1 |
| (CLOSED) prueba 1x | 10/22/10 | 11/11/10 | rascuacho | 0 |
| (CLOSED) Quick & Dirty KnotFind | 12/25/11 | 01/03/12 | SuperNova185 | 1 |
| (CLOSED) Random | 01/28/12 | 01/31/12 | dabanks | 1 |
| (CLOSED) Random Puzzle | 08/03/11 | 08/04/11 | Mp0907 | 0 |
| (CLOSED) Random Puzzle | 08/03/11 | 08/04/11 | Mp0907 | 1 |
| (CLOSED) random test | 10/12/10 | 12/31/10 | Ryanfav | 1 |
| (CLOSED) rc013 | 05/09/12 | 05/31/12 | jlmaccal | 1 |
| (CLOSED) Recipe tester | 05/31/10 | 07/01/10 | Datstandin | 2 |
| (CLOSED) Rentons Madness | 05/31/10 | 06/12/10 | Renton | 1 |
| (CLOSED) ricg contest | 05/17/13 | 05/18/13 | RicGray | 1 |
| (CLOSED) ricgtest | 03/18/13 | 03/24/13 | RicGray | 0 |
| (CLOSED) Rod | 10/08/12 | 10/09/12 | Rodrigo999 | 0 |
| Rodrigo | 10/08/12 | 10/16/15 | Rodrigo999 | 1 |
| Rv0500B - small protein from Mycobacterium tuberculosis H37Rv | 08/24/11 | 08/10/14 | rws | 60 |
| Rv0657c - small protein from Mycobacterium tuberculosis H37Rv | 08/23/11 | 08/31/14 | rws | 38 |
| (CLOSED) SAC Summer 2012 OChem Challenge | 06/04/12 | 06/10/12 | brian.parker | 24 |
| (CLOSED) sample | 05/08/12 | 05/22/12 | govstbiochem | 0 |
| (CLOSED) Sandbox | 10/10/11 | 10/31/12 | kevinjh | 1 |
| (CLOSED) Sandbox puzzle for CASP9 | 05/02/10 | 05/19/10 | beta_helix | 22 |
| (CLOSED) Sandbox-40 | 12/01/10 | 12/02/10 | kevinjh | 1 |
| (CLOSED) Sandbox1 | 02/03/12 | 02/29/12 | nlite510 | 1 |
| (CLOSED) SarNorA | 06/12/12 | 07/12/12 | docsaro | 1 |
| (CLOSED) SAY HI TO ZACH | 10/11/11 | 10/31/11 | za-za22 | 0 |
| (CLOSED) SBG | 02/18/11 | 02/19/11 | crma | 3 |
| (CLOSED) Script test III | 08/12/10 | 10/12/10 | Crashguard303 | 6 |
| (CLOSED) Script Test IV | 09/21/10 | 01/31/11 | Crashguard303 | 1 |
| (CLOSED) Script test ligand | 10/20/10 | 01/31/11 | Crashguard303 | 4 |
| Script tester - Design | 01/01/30 | 05/24/13 | Krog | 1 |
| (CLOSED) Script tester 2 | 07/04/10 | 07/05/12 | Krog | 1 |
| (CLOSED) Script tester 3 | 07/04/10 | 07/08/11 | Krog | 0 |
| (CLOSED) Script tester 3 | 07/04/10 | 07/08/11 | Krog | 1 |
| Script testing | 11/23/12 | 12/31/15 | Jean-Bob | 10 |
| (CLOSED) scritterTest | 02/15/13 | 02/28/13 | scritter | 1 |
| (CLOSED) scritterTest2 | 02/15/13 | 02/28/13 | scritter | 1 |
| (CLOSED) SEAL MYOGLOBIN | 04/28/11 | 05/31/11 | Acida-2 | 1 |
| (CLOSED) seal myoglobin | 12/01/10 | 12/01/12 | traywright | 1 |
| (CLOSED) SEAL MYOGLOBIN | 10/23/10 | 10/30/10 | samwitus | 0 |
| (CLOSED) seal myoglobin | 01/13/12 | 01/31/12 | sum | 1 |
| (CLOSED) seal myoglobin | 01/13/12 | 01/31/12 | sum | 0 |
| (CLOSED) SEAL MYOGLOBIN | 11/23/11 | 01/31/12 | Ch Garnier | 14 |
| (CLOSED) SEAL MYOGLOBIN | 01/02/11 | 01/01/12 | maksimlekler | 1 |
| (CLOSED) Seal Myoglobin | 11/26/11 | 11/29/11 | Lelivret | 1 |
| (CLOSED) SEAL MYOGLOBIN | 05/25/12 | 11/25/12 | Ch Garnier | 19 |
| (CLOSED) Second part | 12/10/12 | 12/24/12 | Placebo | 1 |
| (CLOSED) SemonellaDub | 07/19/10 | 07/31/10 | Renton | 1 |
| (CLOSED) Serine Proline Rich AfCNA | 05/25/12 | 06/28/12 | cookie2004 | 1 |
| (CLOSED) SERPINB5 | 12/19/11 | 12/26/11 | Niubilism | 0 |
| (CLOSED) Server models for T0743 Contest | 10/13/12 | 05/13/13 | Ch Garnier | 12 |
| (CLOSED) Sheet Banding Trick | 03/21/11 | 04/30/11 | itskimo | 0 |
| SHELL | 08/09/12 | 08/08/13 | chingsong | 0 |
| (CLOSED) Short Blank | 10/10/11 | 10/31/12 | kevinjh | 1 |
| (CLOSED) Sim-based Lifecycle Engineering | 02/29/12 | 03/31/12 | mxynidis | 1 |
| (CLOSED) Simpler recipe tester | 05/31/10 | 06/30/10 | Datstandin | 2 |
| (CLOSED) SKHJGFDRSKL | 11/12/10 | 11/30/10 | marshin | 1 |
| slither | 09/16/10 | 12/31/13 | missb | 0 |
| Small Hepatitis B Surface Antigen (HBsAg) | 05/07/13 | 05/07/14 | bigben446 | 1 |
| (CLOSED) Small partial Tspan peptide | 12/21/11 | 12/31/11 | rwarn | 1 |
| (CLOSED) SMIM1 | 03/24/13 | 03/31/13 | gestur | 3 |
| (CLOSED) Some Test Contest | 01/26/12 | 02/05/12 | Biology-EtcManager | 2 |
| (CLOSED) Spielwiese - Freestyle Design (Variable Length) | 12/25/11 | 03/31/12 | Bithalbierer | 4 |
| (CLOSED) Spielwiese - HIV Protease | 12/25/11 | 03/31/12 | Bithalbierer | 7 |
| Spielwiese Freestyle Design 40 | 12/08/12 | 12/31/13 | Bithalbierer | 1 |
| (CLOSED) Stop The HIV Protease | 12/28/12 | 12/31/12 | Evaesion | 1 |
| (CLOSED) Streptococcus pneumoniae | 12/02/12 | 12/31/12 | Placebo | 1 |
| (CLOSED) Streptococcus pneumoniae 80 | 12/02/12 | 12/31/12 | Placebo | 1 |
| (CLOSED) Sugar Binding Puzzle | 07/24/12 | 07/30/12 | beta_helix | 6 |
| (CLOSED) Super Freestyle | 03/27/13 | 04/27/13 | super_Nethergirl | 1 |
| (CLOSED) Super Freestyle | 03/27/13 | 04/27/13 | super_Nethergirl | 1 |
| (CLOSED) Superkittyhorse proteins | 09/27/10 | 12/31/10 | avapenny | 1 |
| (CLOSED) Target 611 - Test | 08/29/10 | 08/30/10 | Cyanoia | 1 |
| Tau Protein (441 residue htau40) | 01/23/13 | 12/31/16 | jinguluninja | 1 |
| Tbf1 | 02/20/13 | 07/17/13 | Rivsie | 1 |
| (CLOSED) Test | 10/15/10 | 10/16/10 | Pyrohmstr | 1 |
| (CLOSED) Test | 10/15/10 | 10/23/10 | Pyrohmstr | 1 |
| test | 08/09/12 | 08/09/13 | chingsong | 0 |
| test | 05/24/11 | 12/31/19 | gurch | 20 |
| (CLOSED) Test | 05/12/13 | 05/17/13 | MurloW | 1 |
| (CLOSED) Test | 07/15/11 | 07/01/12 | berus | 1 |
| test | 10/25/10 | 10/31/13 | centic | 1 |
| (CLOSED) test | 03/11/12 | 03/12/12 | RedVenom | 1 |
| (CLOSED) test | 09/19/10 | 09/20/10 | rangerQ | 1 |
| test | 01/24/13 | 01/01/14 | sonneys | 1 |
| (CLOSED) test | 10/12/11 | 10/13/11 | laurenting | 1 |
| (CLOSED) Test | 06/04/11 | 06/11/11 | Zeljko | 1 |
| (CLOSED) test | 03/13/12 | 03/20/12 | mk18 | 1 |
| Test | 03/09/13 | 07/20/13 | musescience | 1 |
| Test | 04/21/12 | 06/14/13 | paulsen | 0 |
| (CLOSED) test | 08/19/10 | 08/20/10 | beta_helix | 1 |
| (CLOSED) test | 04/16/12 | 04/22/12 | test_account1 | 41 |
| (CLOSED) Test | 08/21/10 | 08/23/10 | Acida-2 | 1 |
| (CLOSED) TEST | 06/14/11 | 06/18/11 | csac1959 | 2 |
| (CLOSED) test | 01/05/11 | 01/06/11 | omelet bob | 1 |
| (CLOSED) test | 01/05/11 | 01/06/11 | omelet bob | 1 |
| (CLOSED) Test | 01/06/11 | 01/13/11 | Roedl | 1 |
| (CLOSED) Test | 06/15/12 | 06/16/12 | xDust | 0 |
| (CLOSED) test | 01/12/12 | 01/31/12 | gurimmer | 0 |
| (CLOSED) test | 01/12/12 | 01/31/12 | gurimmer | 1 |
| (CLOSED) Test 123 | 12/07/12 | 12/14/12 | RicGray | 1 |
| (CLOSED) Test 2 | 03/25/13 | 04/30/13 | RicGray | 0 |
| test 2 | 05/24/11 | 12/31/29 | gurch | 1 |
| (CLOSED) Test area | 06/24/10 | 12/31/10 | mat747 | 1 |
| (CLOSED) Test area - HIV protease | 06/24/10 | 12/31/10 | mat747 | 1 |
| (CLOSED) test asdfg | 07/31/12 | 08/02/12 | Asbiorn | 0 |
| (CLOSED) Test contest | 02/23/12 | 02/23/13 | f1pokerspeed | 1 |
| (CLOSED) Test field 1 | 06/01/12 | 06/02/12 | phi16 | 1 |
| (CLOSED) test for M-SBVfCT | 10/12/12 | 10/13/12 | tjbertram | 0 |
| (CLOSED) test of SmfT0743fCT | 10/12/12 | 10/13/12 | tjbertram | 0 |
| Test Protein | 06/12/12 | 06/12/13 | kurenan | 1 |
| (CLOSED) Test Protein | 12/26/11 | 03/31/12 | kurenan | 1 |
| (CLOSED) Test Puzzle | 12/18/11 | 12/19/11 | kurenan | 1 |
| (CLOSED) Test Puzzle to Fix Client | 02/08/12 | 02/29/12 | beta_helix | 23 |
| (CLOSED) Test Range- HIV Lab | 09/01/10 | 09/05/10 | buddy1018 | 1 |
| (CLOSED) Test Scripting - ZKora | 11/08/12 | 11/30/12 | ZKora | 1 |
| (CLOSED) Test test | 01/06/12 | 01/13/12 | smfuchs | 1 |
| (CLOSED) test test | 05/29/10 | 05/30/10 | CharlieFortsConscience | 1 |
| (CLOSED) test test | 05/19/12 | 05/20/12 | Stolaf | 1 |
| (CLOSED) test-contest | 02/01/12 | 02/02/12 | climax141 | 1 |
| (CLOSED) test00 | 09/29/11 | 09/30/11 | spacevet | 1 |
| (CLOSED) test071 | 10/07/11 | 10/09/11 | b3au071 | 1 |
| (CLOSED) Test2 | 07/15/11 | 07/17/11 | berus | 1 |
| (CLOSED) Test2 | 06/10/11 | 06/17/11 | Zeljko | 0 |
| (CLOSED) Test2 | 02/23/12 | 02/23/13 | 9ct29 | 1 |
| (CLOSED) Testdudetest | 01/31/12 | 02/29/12 | testdudetest | 1 |
| (CLOSED) tester | 06/01/12 | 06/02/12 | CharlieFortsConscience | 2 |
| (CLOSED) Testing Group Contests | 01/09/13 | 01/10/13 | auntdeen | 0 |
| testing own script | 05/13/13 | 12/31/16 | Morus | 1 |
| (CLOSED) Testing Puzzle | 01/15/13 | 01/31/13 | thoyt2012 | 1 |
| (CLOSED) Testing puzzle | 06/03/12 | 10/03/12 | Ch Garnier | 6 |
| (CLOSED) testing the contest | 04/15/10 | 05/15/10 | mat747 | 3 |
| (CLOSED) Test_steveB | 12/01/11 | 12/08/11 | steveB | 1 |
| (CLOSED) TFS dwewf | 04/03/12 | 04/04/12 | jperoff | 2 |
| (CLOSED) The AS challenge | 03/31/11 | 04/17/11 | AgentScience | 0 |
| (CLOSED) The Beginner contest | 06/24/10 | 06/30/10 | Gebauer | 1 |
| (CLOSED) the contest | 10/21/11 | 10/28/11 | Mozzi | 4 |
| (CLOSED) The Final Model | 05/15/13 | 05/16/13 | WheeDhee | 8 |
| The Fountain of Youth | 03/20/13 | 03/31/16 | deinfrank | 0 |
| the grand final | 08/17/10 | 12/31/13 | harlexander | 2 |
| (CLOSED) the great vacation raceoff | 06/01/13 | 09/30/13 | shadow345 | 0 |
| (CLOSED) THE OCTAGON v2 | 02/07/13 | 02/08/13 | nomatic | 1 |
| (CLOSED) the only tournament here! (for now) | 05/10/11 | 06/10/11 | shrock | 2 |
| the protein | 09/07/12 | 09/26/15 | river12345 | 1 |
| (CLOSED) The science is pure science | 08/15/10 | 08/21/10 | Dj-P | 1 |
| (CLOSED) the testing puzzle! | 07/09/12 | 08/31/12 | drumpeter18yrs9yrs | 0 |
| (CLOSED) The unbreakable Loops | 05/30/11 | 09/22/11 | lukis | 0 |
| Theoredoxin | 01/31/12 | 01/31/14 | PeptideMuncher | 1 |
| (CLOSED) thing | 03/03/13 | 03/04/13 | erek | 1 |
| (CLOSED) This freestyle puzzle | 03/18/12 | 04/30/12 | GirichMS | 1 |
| (CLOSED) Threading | 01/06/11 | 01/13/11 | AmyLia330 | 1 |
| (CLOSED) Time to Cure Cancer- Once and For All! | 03/01/11 | 06/01/11 | tyler0911 | 12 |
| (CLOSED) tinglei | 03/09/11 | 03/10/11 | tinglei711 | 0 |
| (CLOSED) Tiroler Nacht der Forschung | 04/25/12 | 04/29/12 | obiwan | 1 |
| (CLOSED) Tiroler Nacht der Forschung 2 | 04/25/12 | 04/29/12 | obiwan | 1 |
| To have fun | 07/29/11 | 07/20/14 | mayumiao | 1 |
| Tobiwankinobi | 02/28/13 | 02/28/14 | Wilm | 0 |
| (CLOSED) Toxic Gluten Molecule | 07/11/12 | 07/29/12 | scooper14 | 6 |
| (CLOSED) Toxic Gluten Peptide | 07/11/12 | 07/29/12 | scooper14 | 6 |
| (CLOSED) TR624 | 10/25/11 | 11/06/11 | beta_helix | 2 |
| (CLOSED) Transmembrane Molecule Modelling | 06/01/12 | 06/30/12 | Beerwing | 1 |
| Trichoplusia ni. Gloverin Protein | 10/12/12 | 12/31/13 | ainstein001 | 1 |
| (CLOSED) Trm7 | 06/14/12 | 06/21/12 | v0lfg0ng | 1 |
| (CLOSED) Truncated human ryanodine receptor 2 | 02/21/11 | 05/31/11 | Fnallerdaller | 1 |
| (CLOSED) Truncated Human Ryanodine Receptor 2 v2 | 02/22/11 | 05/29/11 | Fnallerdaller | 1 |
| (CLOSED) Trying something out :) pardon | 01/31/12 | 02/29/12 | PeptideMuncher | 1 |
| (CLOSED) Tspan peptide 2 | 03/03/12 | 04/01/12 | rwarn | 1 |
| (CLOSED) Twisting of the protein (v.2) | 01/01/11 | 01/31/11 | Dj-P | 5 |
| (CLOSED) Twisting of the protein (v1.0) | 12/28/10 | 04/15/11 | Dj-P | 11 |
| (CLOSED) Two Day Beat Back the Boredom Puzzle | 01/24/13 | 01/26/13 | auntdeen | 14 |
| (CLOSED) UCDS April Contest | 04/01/13 | 04/30/13 | UCDS_A0 | 24 |
| (CLOSED) UCDS Test Contest | 03/25/13 | 04/30/13 | UCDS_Test | 3 |
| (CLOSED) UCSF DNA Challenge | 10/25/11 | 11/06/11 | beta_helix | 3 |
| (CLOSED) UCSF Intro Puzzle | 10/21/11 | 10/25/11 | beta_helix | 21 |
| (CLOSED) Unl. Sandbox | 12/02/10 | 12/31/10 | kevinjh | 1 |
| (CLOSED) Vandeweyer_Protein | 04/22/13 | 04/30/13 | gvandeweyer | 1 |
| (CLOSED) variable freestlye design | 12/21/11 | 12/31/11 | sum | 0 |
| (CLOSED) variable freestlye design | 12/21/11 | 12/31/11 | sum | 1 |
| (CLOSED) Varriable Freestyle | 08/30/12 | 09/30/12 | Dishrat006 | 0 |
| vgsetgethgtr rgwethg | 02/14/13 | 02/14/16 | oxyi | 1 |
| (CLOSED) vhcvhvghgvhjhghjhgjkjyhjgjhjkhkjyh | 05/18/11 | 05/19/11 | oxyi | 1 |
| (CLOSED) virus | 09/02/12 | 12/28/12 | Aqua817 | 1 |
| (CLOSED) VopX | 09/20/11 | 10/20/11 | rabidfurball | 1 |
| (CLOSED) vroom | 01/02/12 | 01/28/12 | kasmol | 1 |
| (CLOSED) vroom2 | 02/24/12 | 03/24/12 | kasmol | 2 |
| (CLOSED) Why not, really? | 12/22/10 | 01/22/11 | anthunk | 10 |
| (CLOSED) Wisks Contest | 04/06/13 | 04/30/13 | Wisk_IRC | 2 |
| (CLOSED) Wolfer's Class | 05/31/12 | 06/06/12 | NTWII | 4 |
| (CLOSED) Wolfer's Class 2 | 05/31/12 | 06/06/12 | NTWII | 1 |
| working in a mutate script | 09/07/12 | 09/01/13 | BitSpawn | 1 |
| (CLOSED) WSU Bioc (S13) | 02/18/13 | 02/20/13 | jcnichols | 37 |
| (CLOSED) ww domain | 01/08/13 | 01/31/13 | deans | 2 |
| (CLOSED) XY | 10/28/10 | 10/29/10 | PdB24 | 1 |
| (CLOSED) xz 07 biotechnology | 09/02/10 | 12/31/10 | xuchenidea | 0 |
| (CLOSED) Yes | 07/24/12 | 07/25/12 | JBrown2322 | 2 |
| ygkas | 08/15/12 | 08/17/13 | sotk | 2 |
| (CLOSED) ygkas 1-80 | 08/23/10 | 08/23/11 | sotk | 1 |
| (CLOSED) ygkas1 40-120 | 08/26/10 | 08/26/11 | sotk | 1 |
| (CLOSED) ygkas2 | 08/11/10 | 08/11/11 | sotk | 0 |
| (CLOSED) Ykl071w Amino acid sequence | 05/09/11 | 05/31/11 | Dendroid | 1 |
| (CLOSED) you betta win | 09/19/12 | 09/23/12 | SOARcmoo | 1 |
| Yu's lab C2E1 | 03/11/12 | 03/01/15 | lijiahua1984 | 1 |
| zhustb | 08/26/12 | 08/25/13 | chingsong | 1 |
| (CLOSED) zzzzzzzzz | 06/10/10 | 06/11/10 | yjh | 0 |
| (CLOSED) все надоемо | 09/24/12 | 09/30/12 | egik1997 | 1 |
![](http://128.95.1.228:8000/tracking_pixel.gif?events=scAdd&f=1111&wdata={"x":12, "y":11}){kind=tracking}
