test 2 | OPEN | 05/24/11 | 12/31/29 | gurch | 1 |
Trp-Cage | OPEN | 04/14/15 | 03/05/21 | ivalnic | 1 |
Freestyle Design 40 | OPEN | 03/02/16 | 11/23/21 | khendarg | 1 |
Freestyle Design 20 | OPEN | 03/02/16 | 01/01/30 | khendarg | 1 |
Contest Template Test and testing | OPEN | 01/01/30 | 03/05/21 | lansefeixue | 1 |
hello world | OPEN | 01/01/30 | 03/05/21 | shan11 | 1 |
sample 1 | OPEN | 01/01/30 | 03/05/21 | walid.alitani | 1 |
BIOL490 | OPEN | 01/01/30 | 03/05/21 | epetruc | 18 |
Testing | OPEN | 01/01/30 | 03/05/21 | Navjot Gill | 2 |
Amyloid Beta Proteins | OPEN | 02/11/21 | 03/11/21 | JlopezYU | 14 |
FREESTYLE puzzle | OPEN | 02/19/21 | 03/18/21 | JPS838898 | 2 |
my roooooooooooooooom | OPEN | 03/02/21 | 03/31/21 | smbourgleh | 2 |
gyfwgfsgfuyfyu jsyfrfaa4tw4r | OPEN | 03/02/21 | 03/31/21 | smbourgleh | 2 |
SHELL-backtofuture | OPEN | 03/03/21 | 04/02/21 | chingsong | 53 |
2x rules | OPEN | 03/03/21 | 03/05/21 | Bachus80 | 15 |
Greek Key Assignment | OPEN | 03/03/21 | 03/31/21 | jakelmer | 2 |
SHELL-backtofuture2 | OPEN | 03/04/21 | 04/03/21 | chingsong | 41 |
SHELL-backtofuture3 | OPEN | 03/04/21 | 04/03/21 | chingsong | 9 |
NCAM2 | OPEN | 03/04/21 | 04/04/21 | yisoliman | 0 |
40 Seg Design Contest | CLOSED | 04/15/10 | 04/20/10 | TheGUmmer | 3 |
testing the contest | CLOSED | 04/15/10 | 05/15/10 | mat747 | 3 |
Another Contest | CLOSED | 04/17/10 | 04/22/10 | TheGUmmer | 2 |
'Brave New World' Class Puzzle | CLOSED | 04/22/10 | 05/02/10 | beta_helix | 25 |
Sandbox puzzle for CASP9 | CLOSED | 05/02/10 | 05/19/10 | beta_helix | 22 |
protein to test scripts | CLOSED | 05/22/10 | 12/31/10 | smith92clone | 1 |
CASP9 611 residue | CLOSED | 05/29/10 | 06/15/10 | Mark- | 4 |
test test | CLOSED | 05/29/10 | 05/30/10 | CharlieFortsConscience | 1 |
Recipe tester | CLOSED | 05/31/10 | 07/01/10 | Datstandin | 2 |
Simpler recipe tester | CLOSED | 05/31/10 | 06/30/10 | Datstandin | 2 |
Script tester - Design | CLOSED | 01/01/30 | 05/24/13 | Krog | 1 |
Beginner puzzle copy | CLOSED | 05/31/10 | 05/18/12 | Krog | 1 |
Even simpler recipe tester | CLOSED | 05/31/10 | 06/30/10 | Datstandin | 1 |
20 seg script test | CLOSED | 06/05/10 | 12/31/10 | srssmith92 | 1 |
Crashguard303 Script test | CLOSED | 06/07/10 | 06/14/10 | Crashguard303 | 3 |
aendgraend tested contests | CLOSED | 06/09/10 | 06/13/10 | aendgraend | 1 |
assasa | CLOSED | 06/10/10 | 06/11/10 | yjh | 1 |
565645646 | CLOSED | 06/11/10 | 06/12/10 | yjh | 0 |
zzzzzzzzz | CLOSED | 06/10/10 | 06/11/10 | yjh | 0 |
New small test | CLOSED | 06/17/10 | 07/30/10 | Crashguard303 | 4 |
The Beginner contest | CLOSED | 06/24/10 | 06/30/10 | Gebauer | 1 |
Test area | CLOSED | 06/24/10 | 12/31/10 | mat747 | 1 |
Test area - HIV protease | CLOSED | 06/24/10 | 12/31/10 | mat747 | 1 |
Freestyle 80 for a month | CLOSED | 06/25/10 | 07/31/10 | sehskyle | 1 |
Script tester 2 | CLOSED | 07/04/10 | 07/05/12 | Krog | 1 |
Script tester 3 | CLOSED | 07/04/10 | 07/08/11 | Krog | 0 |
Script tester 3 | CLOSED | 07/04/10 | 07/08/11 | Krog | 1 |
find the various aminos | CLOSED | 07/06/10 | 12/31/10 | smith92clone | 2 |
M | CLOSED | 07/05/10 | 07/31/13 | RoboMonkey | 1 |
asdfadf | CLOSED | 07/05/10 | 07/29/10 | RoboMonkey | 1 |
a | CLOSED | 07/11/10 | 07/25/10 | asianboy26 | 1 |
80segment | CLOSED | 07/12/10 | 07/31/10 | asianboy26 | 1 |
a.l | CLOSED | 07/13/10 | 07/15/10 | asianboy26 | 1 |
hiv protease | CLOSED | 07/11/10 | 07/17/10 | asianboy26 | 1 |
GTPase | CLOSED | 07/11/10 | 08/31/10 | Jordandk | 1 |
40 segment | CLOSED | 07/16/10 | 07/18/10 | icreatemac | 0 |
math modeling | CLOSED | 07/16/10 | 07/29/12 | themarquis | 1 |
Anyone Can Join (freestyle design 80) | CLOSED | 07/19/10 | 07/18/11 | spy club | 202 |
Contest name goes here? | CLOSED | 08/02/10 | 08/05/10 | oakwhiz | 1 |
ygkas2 | CLOSED | 08/11/10 | 08/11/11 | sotk | 0 |
Script test III | CLOSED | 08/12/10 | 10/12/10 | Crashguard303 | 6 |
Phalpha1beta | CLOSED | 08/14/10 | 08/15/10 | mvackel | 1 |
Align-it | CLOSED | 08/14/10 | 08/21/10 | Arbot360 | 20 |
CD44 protein | CLOSED | 08/14/10 | 08/24/10 | mikedressner | 1 |
The science is pure science | CLOSED | 08/15/10 | 08/21/10 | Dj-P | 1 |
the grand final | CLOSED | 08/17/10 | 12/31/13 | cyclic3 | 2 |
ygkas | CLOSED | 08/13/13 | 08/17/14 | sotk | 2 |
GTPase Ras | CLOSED | 08/18/10 | 08/31/10 | cyclic3 | 1 |
Let's Cure Cancer Finally | CLOSED | 08/18/10 | 12/31/13 | mikedressner | 691 |
1 | CLOSED | 08/19/10 | 08/31/10 | lipasesucks | 1 |
12 | CLOSED | 08/19/10 | 08/31/10 | lipasesucks | 1 |
test | CLOSED | 08/19/10 | 08/20/10 | beta_helix | 1 |
HiV try | CLOSED | 08/20/10 | 09/20/10 | Pyotr | 1 |
Test | CLOSED | 08/21/10 | 08/23/10 | Acida-2 | 1 |
HIV fight! | CLOSED | 08/22/10 | 08/31/10 | Rav3n_pl | 29 |
Freestyle Design 80 | CLOSED | 08/21/10 | 10/31/10 | Handful | 1 |
motor protein tail | CLOSED | 08/23/10 | 08/23/11 | ceventer | 1 |
ygkas 1-80 | CLOSED | 08/23/10 | 08/23/11 | sotk | 1 |
One last CASP9 Target! | CLOSED | 08/25/10 | 09/28/10 | beta_helix | 74 |
Calzolai | CLOSED | 09/01/10 | 11/08/10 | iRob | 0 |
ygkas1 40-120 | CLOSED | 08/26/10 | 08/26/11 | sotk | 1 |
Target 611 - Test | CLOSED | 08/29/10 | 08/30/10 | Cyanoia | 1 |
BattleGrounds....v.5655.88 | CLOSED | 08/31/10 | 08/24/13 | InsaneGamer1457 | 1 |
my contest | CLOSED | 09/01/10 | 09/02/10 | marissa101 | 0 |
Loss Cancer | CLOSED | 08/31/10 | 12/31/10 | FalconDeOro | 1 |
Aids Security | CLOSED | 09/02/10 | 01/22/11 | Gaara | 1 |
Test Range- HIV Lab | CLOSED | 09/01/10 | 09/05/10 | buddy1018 | 1 |
xz 07 biotechnology | CLOSED | 09/02/10 | 12/31/10 | xuchenidea | 0 |
bonebreake | CLOSED | 09/09/10 | 09/17/10 | baeda | 1 |
Dubons Class Contest | CLOSED | 09/08/10 | 09/10/10 | dubon1 | 2 |
Giordano's Class | CLOSED | 09/09/10 | 09/13/10 | cgiordano | 0 |
BP's 611 | CLOSED | 09/10/10 | 09/11/10 | Bletchley Park | 1 |
PhAlpha1Beta | CLOSED | 09/12/10 | 09/13/10 | mvackel | 1 |
PhAlpha1Beta | CLOSED | 09/12/10 | 09/15/10 | mvackel | 1 |
Contest10000G1 | CLOSED | 09/14/10 | 10/01/10 | crispy fry | 1 |
slither | CLOSED | 09/16/10 | 12/31/13 | missb | 0 |
HIV protease | CLOSED | 09/17/10 | 09/18/10 | skoddet1 | 20 |
best score | CLOSED | 09/17/10 | 09/21/10 | Willbee | 1 |
test | CLOSED | 09/19/10 | 09/20/10 | rangerQ | 1 |
easy!!!! :o) | CLOSED | 10/01/10 | 12/31/13 | yomama | 0 |
Bioinfor Kaset | CLOSED | 09/19/10 | 09/27/10 | kiattawee | 17 |
Fold It (or else) | CLOSED | 09/20/10 | 09/26/10 | Zeff | 0 |
Fold It (or else) | CLOSED | 09/20/10 | 09/26/10 | Zeff | 0 |
Long Contest | CLOSED | 09/20/10 | 01/01/12 | maquiladora | 1 |
free style 500 | CLOSED | 09/20/10 | 10/31/10 | ethanIc | 1 |
Script Test IV | CLOSED | 09/21/10 | 01/31/11 | Crashguard303 | 1 |
Acida's test | CLOSED | 09/22/10 | 09/30/10 | Acida-2 | 15 |
mva1alpha | CLOSED | 09/22/10 | 09/21/11 | mvackel | 1 |
AP BIO Extra Credit | CLOSED | 09/24/10 | 09/25/10 | jesalomone11 | 6 |
Superkittyhorse proteins | CLOSED | 09/27/10 | 12/31/10 | avapenny | 1 |
Need structure | CLOSED | 09/29/10 | 10/10/10 | canikickit49 | 1 |
Alignment | CLOSED | 10/02/10 | 12/31/10 | sielenk | 1 |
Alignment | CLOSED | 10/02/10 | 12/31/10 | sielenk | 0 |
bjarke join mig | CLOSED | 10/04/10 | 10/05/10 | aske2010 | 2 |
AATG TK Bioteknologi | CLOSED | 10/04/10 | 10/08/10 | thomas.holm@gmail.com | 1 |
random test | CLOSED | 10/12/10 | 12/31/10 | Ryanfav | 1 |
Beta-carotene dioxygenase | CLOSED | 10/13/10 | 11/05/10 | mbarnkob | 0 |
kanya | CLOSED | 10/14/10 | 10/26/10 | g5314401673 | 1 |
khc test | CLOSED | 10/14/10 | 10/14/11 | ceventer | 1 |
prueba 1x | CLOSED | 10/22/10 | 11/11/10 | rascuacho | 0 |
Test | CLOSED | 10/15/10 | 10/16/10 | Pyrohmstr | 1 |
Test | CLOSED | 10/15/10 | 10/23/10 | Pyrohmstr | 1 |
Freestyle Design 80 | CLOSED | 10/17/10 | 10/01/11 | BlueRabit | 1 |
meh | CLOSED | 10/17/10 | 10/31/10 | anthunk | 1 |
GFP | CLOSED | 10/18/10 | 10/30/10 | Pyrohmstr | 1 |
GFP | CLOSED | 10/18/10 | 10/30/10 | Pyrohmstr | 0 |
GFP1 | CLOSED | 10/18/10 | 10/30/10 | Pyrohmstr | 1 |
Script test ligand | CLOSED | 10/20/10 | 01/31/11 | Crashguard303 | 4 |
P1a1b | CLOSED | 10/22/10 | 10/21/11 | mvackel | 1 |
SEAL MYOGLOBIN | CLOSED | 10/23/10 | 10/30/10 | samwitus | 0 |
niep | CLOSED | 10/24/10 | 10/26/10 | niep0329 | 1 |
CASP9 Target 611 | CLOSED | 10/24/10 | 11/30/10 | cd11 | 1 |
test | CLOSED | 10/25/10 | 10/31/13 | centic | 1 |
XY | CLOSED | 10/28/10 | 10/29/10 | PdB24 | 1 |
Freestyle for all | CLOSED | 11/01/10 | 12/05/10 | thosi | 3 |
Beginner Alignment puzzle | CLOSED | 11/04/10 | 11/11/10 | science.nerd | 0 |
Foldit University Challenge | CLOSED | 11/05/10 | 11/19/10 | ilya.makedon | 47 |
PdB24 | CLOSED | 11/05/10 | 02/01/11 | PdB24 | 0 |
PdB24 | CLOSED | 11/05/10 | 02/01/11 | PdB24 | 1 |
Alabudzki | CLOSED | 11/06/10 | 12/31/10 | alabudzki | 1 |
MRMAND123 | CLOSED | 11/09/11 | 11/09/12 | MR MAN D | 1 |
hard | CLOSED | 11/13/10 | 12/31/10 | marshin | 1 |
hiv | CLOSED | 11/12/10 | 01/16/11 | marshin | 1 |
hotu | CLOSED | 11/12/10 | 11/30/10 | marshin | 1 |
SKHJGFDRSKL | CLOSED | 11/12/10 | 11/30/10 | marshin | 1 |
Design a protein | CLOSED | 11/18/10 | 12/18/10 | svenskhan | 1 |
Open University Challenge | CLOSED | 11/20/10 | 12/18/10 | ilya.makedon | 2 |
Free Challenge for University Students | CLOSED | 11/18/10 | 12/18/10 | ilya.makedon | 0 |
Daddy's | CLOSED | 11/30/10 | 12/25/10 | TheDaddyTired | 0 |
seal myoglobin | CLOSED | 12/01/10 | 12/01/12 | traywright | 1 |
Sandbox-40 | CLOSED | 12/01/10 | 12/02/10 | kevinjh | 1 |
Unl. Sandbox | CLOSED | 12/02/10 | 12/31/10 | kevinjh | 1 |
'for everyone | CLOSED | 12/04/10 | 01/09/11 | anthunk | 67 |
Grand master rival challenge | CLOSED | 01/01/11 | 12/31/11 | Malzarg | 0 |
BiChE Easy puzzle | CLOSED | 12/08/10 | 12/10/10 | ejf3c | 1 |
AIDS | CLOSED | 12/08/10 | 12/31/11 | colonelpaco | 1 |
Freestyle Design 500 | CLOSED | 12/09/10 | 12/12/10 | MHannigan | 1 |
Fun | CLOSED | 12/12/10 | 12/31/10 | bost29 | 1 |
Alignment battle | CLOSED | 12/12/10 | 12/31/10 | Nikaeo | 4 |
Large Protein Test | CLOSED | 12/14/10 | 12/15/10 | Gray Thomas | 1 |
Pedobacter Beta Barrel | CLOSED | 12/14/10 | 12/25/10 | Gray Thomas | 1 |
Freestyle Design this 500 residue protein - Seagat2011 | CLOSED | 12/17/10 | 01/14/12 | Seagat2011 | 50 |
?? | CLOSED | 12/20/10 | 01/01/11 | reedbc | 1 |
HIV Crash test | CLOSED | 12/21/10 | 12/31/11 | Dr Tyrell | 1 |
Freestyle Multi-start 499.9 | CLOSED | 12/22/10 | 01/01/11 | Dj-P | 1 |
AT Testing | CLOSED | 12/22/10 | 12/26/10 | anthunk | 1 |
FreestyleBKG | CLOSED | 12/22/10 | 12/31/13 | aricc | 1 |
AT Testing Too | CLOSED | 12/22/10 | 12/26/10 | anthunk | 1 |
Why not, really? | CLOSED | 12/22/10 | 01/22/11 | anthunk | 10 |
Beginning Alignment Puzzle | CLOSED | 02/04/11 | 02/12/11 | ltchong | 0 |
CHEM 1460 Puzzle | CLOSED | 02/04/11 | 02/12/11 | ltchong | 1 |
CHEM 1460 Puzzle 2 | CLOSED | 02/04/11 | 02/11/11 | ltchong | 1 |
FOLD Championship | CLOSED | 12/23/10 | 12/31/10 | Dj-P | 1 |
GTPase Ras 1.0 | CLOSED | 12/23/10 | 12/31/10 | Dj-P | 1 |
F20 for testing | CLOSED | 12/24/10 | 02/28/11 | Rav3n_pl | 8 |
Twisting of the protein (v1.0) | CLOSED | 12/28/10 | 04/15/11 | Dj-P | 11 |
Twisting of the protein (v.2) | CLOSED | 01/01/11 | 01/31/11 | Dj-P | 5 |
CASP 9: Nycticorax nycticorax's mystery. | CLOSED | 01/01/11 | 01/15/11 | Dj-P | 14 |
HIV protease | CLOSED | 01/02/11 | 01/01/12 | maksimlekler | 1 |
Beginner Alignment Puzzle | CLOSED | 01/02/11 | 01/01/12 | maksimlekler | 1 |
CASP training puzzle | CLOSED | 01/02/11 | 01/01/12 | maksimlekler | 1 |
CASP9 Target 611 residue protein | CLOSED | 01/02/11 | 01/01/12 | maksimlekler | 1 |
CASP9 target Design? | CLOSED | 01/02/11 | 01/01/12 | maksimlekler | 1 |
SEAL MYOGLOBIN | CLOSED | 01/02/11 | 01/01/12 | maksimlekler | 1 |
Contest Template Test | CLOSED | 01/02/11 | 01/01/12 | maksimlekler | 1 |
Histone H1 | CLOSED | 01/03/11 | 01/31/11 | Dj-P | 4 |
Blank | CLOSED | 01/04/11 | 12/31/11 | kevinjh | 1 |
LUA test | CLOSED | 01/05/11 | 01/30/11 | Dj-P | 1 |
test | CLOSED | 01/05/11 | 01/06/11 | omelet bob | 1 |
test | CLOSED | 01/05/11 | 01/06/11 | omelet bob | 1 |
Test | CLOSED | 01/06/11 | 01/13/11 | Roedl | 1 |
Threading | CLOSED | 01/06/11 | 01/13/11 | AmyLia330 | 1 |
Halobacterium NRC-1 Hypothetical Protein | CLOSED | 01/08/11 | 05/31/11 | pramodbhat | 1 |
Pass the Thyme | CLOSED | 01/09/11 | 02/28/11 | TheGUmmer | 1 |
HIV protease | CLOSED | 01/09/11 | 12/31/14 | Alegend45 | 1 |
Freestyle Design Variable Length | CLOSED | 01/09/11 | 01/01/12 | ten04031977 | 1 |
mine silly | CLOSED | 01/17/11 | 12/31/11 | anthunk | 1 |
Laccase | CLOSED | 01/19/11 | 01/23/11 | El_Crazy_Xabi | 1 |
Bioc670_1 | CLOSED | 01/22/11 | 02/10/11 | bkuhlman | 24 |
BioContest | CLOSED | 01/27/11 | 01/28/11 | cbehling | 2 |
Black box42 | CLOSED | 02/09/11 | 02/11/11 | DaVinci21 | 1 |
HIV's end | CLOSED | 02/13/11 | 12/31/14 | Dj-P | 305 |
binding motif test | CLOSED | 02/16/11 | 02/03/12 | ceventer | 1 |
Dj-P's duel puzzle | CLOSED | 02/17/11 | 02/18/11 | Dj-P | 1 |
SBG | CLOSED | 02/18/11 | 02/19/11 | crma | 3 |
god berry | CLOSED | 02/18/11 | 03/12/11 | My Cranky Panda | 1 |
first | CLOSED | 02/20/11 | 12/31/11 | jojotastic777 | 1 |
Truncated human ryanodine receptor 2 | CLOSED | 02/21/11 | 05/31/11 | Fnallerdaller | 1 |
2011-11 small Freestyle | CLOSED | 02/22/11 | 12/31/11 | Crashguard303 | 4 |
Truncated Human Ryanodine Receptor 2 v2 | CLOSED | 02/22/11 | 05/29/11 | Fnallerdaller | 1 |
first | CLOSED | 02/25/11 | 12/31/11 | alex2011 | 1 |
Time to Cure Cancer- Once and For All! | CLOSED | 03/01/11 | 06/01/11 | tyler0911 | 12 |
CASP9 targed Design test, all welcome | CLOSED | 03/01/11 | 07/01/11 | tyler0911 | 1 |
bugster | CLOSED | 03/05/11 | 04/30/11 | alex2011 | 1 |
The AS challenge | CLOSED | 03/31/11 | 04/17/11 | AgentScience | 0 |
Chem 2225 Spring 2011 Contest | CLOSED | 03/09/11 | 03/31/11 | brian.parker | 7 |
Chem 1307 Spring 2011 Contest | CLOSED | 03/09/11 | 03/31/11 | brian.parker | 13 |
tinglei | CLOSED | 03/09/11 | 03/10/11 | tinglei711 | 0 |
Pregnancy Associated Plasma Protein (PAPP-A) | CLOSED | 03/12/11 | 08/15/11 | meschruhms | 1 |
CRAZY | CLOSED | 03/12/11 | 03/17/11 | alex2011 | 1 |
contest | CLOSED | 03/19/11 | 05/22/11 | protein123 | 1 |
biol200-3-23-11 | CLOSED | 04/04/11 | 04/09/11 | gabhsa | 12 |
Sheet Banding Trick | CLOSED | 03/21/11 | 04/30/11 | itskimo | 0 |
etrg | CLOSED | 03/26/11 | 12/31/14 | oxyi | 0 |
etrg | CLOSED | 03/26/11 | 12/31/14 | oxyi | 0 |
etrg | CLOSED | 03/26/11 | 12/31/14 | oxyi | 0 |
lv.1 | CLOSED | 03/28/11 | 04/03/11 | Marco Chan | 1 |
Beginners game | CLOSED | 04/11/11 | 04/17/11 | Zsolesz84 | 0 |
khc head | CLOSED | 04/13/11 | 04/20/13 | ceventer | 0 |
kk's contest | CLOSED | 04/20/11 | 04/30/11 | kkwizard101 | 1 |
Freestyle Design: Variable Length | CLOSED | 04/28/11 | 05/31/11 | Acida-2 | 1 |
Freestyle Design 500 | CLOSED | 04/28/11 | 05/31/11 | Acida-2 | 4 |
SEAL MYOGLOBIN | CLOSED | 04/28/11 | 05/31/11 | Acida-2 | 1 |
Ligand Folding Practice- Open to all | CLOSED | 05/01/11 | 09/01/11 | tyler0911 | 23 |
HIV protease sandbox | CLOSED | 05/04/11 | 05/01/14 | tyler0911 | 49 |
more testing | CLOSED | 05/04/11 | 12/31/14 | anthunk | 1 |
Easy first alignment | CLOSED | 05/09/11 | 05/31/11 | serico7 | 1 |
Ykl071w Amino acid sequence | CLOSED | 05/09/11 | 05/31/11 | Dendroid | 1 |
the only tournament here! (for now) | CLOSED | 05/10/11 | 06/10/11 | shrock | 2 |
vhcvhvghgvhjhghjhgjkjyhjgjhjkhkjyh | CLOSED | 05/18/11 | 05/19/11 | oxyi | 1 |
dhtrjkg vbuibmjjmknv n bogf bjh mknknb | CLOSED | 05/18/11 | 05/19/11 | oxyi | 1 |
dhtrjkg vbuibmjjmknv n bogf bjh mknkn | CLOSED | 05/18/11 | 05/19/14 | oxyi | 1 |
dhtrjkg vbuibmjjmknv n bogf bjh mknkn | CLOSED | 05/18/11 | 05/19/14 | oxyi | 1 |
576i | CLOSED | 05/21/11 | 12/31/14 | oxyi | 1 |
test | CLOSED | 05/24/11 | 12/31/19 | gurch | 237 |
fbdfnbdgn | CLOSED | 05/23/11 | 12/31/14 | oxyi | 1 |
Ligand Practice | CLOSED | 05/24/11 | 09/11/11 | tyler0911 | 3 |
HIV protease contest! | CLOSED | 05/29/11 | 05/31/11 | chouti | 1 |
The unbreakable Loops | CLOSED | 05/30/11 | 09/22/11 | lukis | 0 |
Test | CLOSED | 06/04/11 | 06/11/11 | Zeljko | 1 |
Test2 | CLOSED | 06/10/11 | 06/17/11 | Zeljko | 0 |
HIV attack | CLOSED | 06/05/11 | 06/30/12 | Overlord13 | 1 |
TEST | CLOSED | 06/14/11 | 06/18/11 | csac1959 | 2 |
Homology_Praktikum_IBK_SS11 | CLOSED | 06/16/11 | 06/20/11 | csac1959 | 9 |
m,jb ghj | CLOSED | 06/15/11 | 12/31/14 | oxyi | 0 |
m,jb ghj | CLOSED | 06/15/11 | 12/31/14 | oxyi | 1 |
hnvfcfhncfh kbkkkh | CLOSED | 06/15/11 | 12/31/14 | oxyi | 1 |
Freestyle Design - 80 (Anthropic Dreams team members) | CLOSED | 06/17/11 | 06/22/11 | Seagat2011 | 4 |
Freestyle Design - 20 (ST - Recipe Research Channel) | CLOSED | 06/18/11 | 06/30/11 | Seagat2011 | 1 |
Freestyle Design Competition | CLOSED | 06/20/11 | 06/30/11 | Dinoclor | 1 |
any one can join too | CLOSED | 06/26/11 | 09/01/11 | plh | 1 |
contest | CLOSED | 06/26/11 | 07/13/11 | madpenguin | 2 |
vghubzysd rx | CLOSED | 07/31/11 | 12/31/13 | oxyi | 1 |
anyone can join (actually) | CLOSED | 07/05/11 | 12/16/11 | madpenguin | 0 |
Atoh1 Atonal homolog 1 | CLOSED | 07/11/11 | 08/01/11 | RANimick | 0 |
Laurabee's puzzle | CLOSED | 07/13/11 | 07/14/11 | laurabee | 0 |
Test | CLOSED | 07/15/11 | 07/01/12 | berus | 1 |
Test2 | CLOSED | 07/15/11 | 07/17/11 | berus | 1 |
Freebuild | CLOSED | 07/18/11 | 07/20/11 | e-wok456 | 1 |
Freestyle Competition | CLOSED | 07/19/11 | 07/26/11 | rattlesnake8 | 0 |
freebuild2 | CLOSED | 07/18/11 | 07/20/11 | e-wok456 | 1 |
Alignment test | CLOSED | 07/23/11 | 07/24/11 | harvardman | 0 |
Let's have fun. | CLOSED | 07/25/11 | 08/02/11 | etety33 | 1 |
Mr Ma No.1 | CLOSED | 07/27/11 | 07/31/12 | mayumiao | 1 |
To have fun | CLOSED | 07/29/11 | 07/20/14 | mayumiao | 1 |
Mr Ma No. One | CLOSED | 07/29/11 | 07/29/14 | mayumiao | 1 |
Random Puzzle | CLOSED | 08/03/11 | 08/04/11 | Mp0907 | 0 |
Random Puzzle | CLOSED | 08/03/11 | 08/04/11 | Mp0907 | 1 |
430 | CLOSED | 08/03/11 | 08/04/11 | laurabee | 1 |
PODXL | CLOSED | 08/04/11 | 08/26/11 | machoo | 1 |
Rv0500B - small protein from Mycobacterium tuberculosis H37Rv | CLOSED | 08/24/11 | 08/10/14 | rws | 92 |
A Freestyle Design 80 Open to all | CLOSED | 08/14/11 | 09/30/12 | itskimo | 69 |
A Freestyle Design 40 Open to all | CLOSED | 08/14/11 | 08/31/12 | itskimo | 68 |
A Freestyle Design 20 Open to all | CLOSED | 08/14/11 | 08/31/12 | itskimo | 288 |
Freestyle Simple | CLOSED | 08/19/11 | 08/21/14 | WheelerLovett | 0 |
Freestyle Simple | CLOSED | 08/19/11 | 08/21/14 | WheelerLovett | 1 |
laura test | CLOSED | 08/23/11 | 08/24/11 | laurabee | 1 |
laura test2 | CLOSED | 08/23/11 | 08/24/11 | laurabee | 1 |
Chem 431 contest | CLOSED | 08/24/11 | 09/19/11 | laurabee | 28 |
Compbio | CLOSED | 08/22/11 | 08/23/11 | hahnbeom | 5 |
Compbio2 | CLOSED | 08/22/11 | 08/23/11 | hahnbeom | 5 |
Compbio3 | CLOSED | 08/22/11 | 08/23/11 | hahnbeom | 5 |
Compbio4 | CLOSED | 08/22/11 | 08/23/11 | hahnbeom | 5 |
MediumFREE STYLE | CLOSED | 08/23/11 | 08/31/14 | WheelerLovett | 0 |
MediumFREE STYLE | CLOSED | 08/23/11 | 08/31/14 | WheelerLovett | 1 |
BIG CASP9 contest | CLOSED | 08/23/11 | 02/01/12 | wudoo | 68 |
Rv0657c - small protein from Mycobacterium tuberculosis H37Rv | CLOSED | 08/23/11 | 08/31/14 | rws | 61 |
LETSGO | CLOSED | 08/26/11 | 08/27/11 | wudoo | 4 |
A HIV Protease open to all | CLOSED | 08/27/11 | 09/30/12 | itskimo | 496 |
A GTPase Ras Open To All | CLOSED | 08/27/11 | 09/30/12 | itskimo | 131 |
GTPase Ras | CLOSED | 09/10/11 | 09/01/12 | glenwayguy | 1 |
VopX | CLOSED | 09/20/11 | 10/20/11 | rabidfurball | 1 |
my contest | CLOSED | 09/20/11 | 12/20/11 | Lysergic cure | 1 |
Freestyle | CLOSED | 09/21/11 | 09/29/11 | Stano28 | 0 |
Dengue Virus NS3 protease domain | CLOSED | 09/26/11 | 10/31/11 | Neffets | 1 |
arabic group | CLOSED | 09/22/11 | 09/22/14 | ahmed magdy | 1 |
GTPase Ras | CLOSED | 09/23/11 | 10/07/11 | Miah | 2 |
aj | CLOSED | 09/23/11 | 09/24/11 | ilikeike | 1 |
CURE CANCER win | CLOSED | 09/24/11 | 09/25/12 | Ross3 | 1 |
Facile for Italian :) | CLOSED | 09/24/11 | 10/24/11 | Vaio | 1 |
Multi-histidine and Glutamate sequence complexed with Mn(II) | CLOSED | 09/26/11 | 10/10/11 | masspeana | 1 |
BCHS 3201 | CLOSED | 09/26/11 | 11/30/11 | Fotis NKS | 0 |
BCHS 3201 | CLOSED | 09/26/11 | 11/30/11 | Fotis NKS | 0 |
j | CLOSED | 09/30/11 | 10/01/11 | klixovann | 0 |
contest | CLOSED | 09/27/11 | 12/25/11 | meganium214 | 0 |
contest | CLOSED | 09/27/11 | 12/25/11 | meganium214 | 0 |
HIV protease new | CLOSED | 09/29/11 | 10/31/11 | davidpat | 1 |
test00 | CLOSED | 09/29/11 | 09/30/11 | spacevet | 1 |
Michael and Marco | CLOSED | 10/05/11 | 10/06/11 | bigbanggd410 | 0 |
Michael and Marco | CLOSED | 10/05/11 | 10/06/11 | bigbanggd410 | 0 |
Michael and Marco | CLOSED | 10/05/11 | 10/06/11 | bigbanggd410 | 2 |
test071 | CLOSED | 10/07/11 | 10/09/11 | b3au071 | 1 |
efeli | CLOSED | 10/11/11 | 10/12/11 | chatask | 1 |
HIV challenge | CLOSED | 10/09/11 | 10/30/11 | ofc2000 | 0 |
ClpB | CLOSED | 10/09/11 | 10/28/12 | kevinjh | 1 |
Short Blank | CLOSED | 10/10/11 | 10/31/12 | kevinjh | 1 |
Sandbox | CLOSED | 10/10/11 | 10/31/12 | kevinjh | 1 |
SAY HI TO ZACH | CLOSED | 10/11/11 | 10/31/11 | za-za22 | 0 |
test | CLOSED | 10/12/11 | 10/13/11 | laurenting | 1 |
BMI 206 test contest - protease | CLOSED | 10/12/11 | 10/13/11 | amelie.stein | 1 |
BMI 206 test contest - Ras | CLOSED | 10/12/11 | 10/14/11 | amelie.stein | 1 |
Freestyle Design 500 | CLOSED | 10/16/11 | 11/06/11 | ofc2000 | 1 |
HIV protease | CLOSED | 10/17/11 | 10/22/11 | Joshua Algode | 1 |
UCSF Intro Puzzle | CLOSED | 10/21/11 | 10/25/11 | beta_helix | 21 |
TR624 | CLOSED | 10/25/11 | 11/06/11 | beta_helix | 2 |
GTPase Ras | CLOSED | 10/19/11 | 03/18/12 | wangyueyun | 1 |
hiv protease | CLOSED | 10/19/11 | 10/19/12 | jerrywhite13 | 1 |
casp training | CLOSED | 10/20/11 | 10/31/11 | vk1982 | 1 |
the contest | CLOSED | 10/21/11 | 10/28/11 | Mozzi | 4 |
first contest | CLOSED | 10/20/11 | 10/21/11 | Robinso | 1 |
UCSF DNA Challenge | CLOSED | 10/25/11 | 11/06/11 | beta_helix | 3 |
Alignment tool (join link in desc) | CLOSED | 10/26/11 | 12/31/11 | riking | 7 |
My first contest | CLOSED | 10/26/11 | 10/31/11 | awesome4132 | 1 |
ACP | CLOSED | 10/27/11 | 10/12/12 | mike r | 0 |
ACP | CLOSED | 10/27/11 | 10/12/12 | mike r | 1 |
ofc2000's tough challenge (open) | CLOSED | 10/29/11 | 10/31/11 | ofc2000 | 1 |
just do it | CLOSED | 10/30/11 | 12/31/11 | pokemon.guy | 0 |
One day challenge | CLOSED | 11/04/11 | 11/05/11 | scienceschmoo | 0 |
One day challenge | CLOSED | 11/04/11 | 11/05/11 | scienceschmoo | 1 |
Dog tests himself | CLOSED | 11/07/11 | 11/08/11 | est000dog | 1 |
JJJP bmi206 fold | CLOSED | 11/07/11 | 11/30/11 | Peter2000 | 0 |
PA1955_Repeat | CLOSED | 11/10/11 | 12/23/11 | MadsTS | 1 |
Polish Contest | CLOSED | 11/20/11 | 12/20/11 | Mojzesz | 4 |
SEAL MYOGLOBIN | CLOSED | 11/23/11 | 01/31/12 | Ch Garnier | 14 |
hemoglobin check | CLOSED | 11/26/11 | 11/30/11 | Rellis | 1 |
GTPase Ras | CLOSED | 11/25/11 | 12/31/11 | O Seki To | 0 |
Seal Myoglobin | CLOSED | 11/26/11 | 11/29/11 | Lelivret | 1 |
a | CLOSED | 11/27/11 | 12/19/11 | JimmyFraktal | 1 |
asf | CLOSED | 11/27/11 | 11/30/11 | JimmyFraktal | 0 |
Myoglobin | CLOSED | 11/30/11 | 12/23/11 | Ronald Wichman | 0 |
Test_steveB | CLOSED | 12/01/11 | 12/08/11 | steveB | 1 |
Governors Academy Freestylin' | CLOSED | 12/02/11 | 12/04/11 | conorodea111 | 1 |
jnkljnklhjnljnljnl | CLOSED | 12/04/11 | 12/31/11 | oxyi | 0 |
jnkljnklhjnljnljnl | CLOSED | 12/04/11 | 12/31/11 | oxyi | 1 |
Beginner Alignment Puzzle | CLOSED | 12/06/11 | 12/31/11 | kitek314_pl | 1 |
A Computer Tester | CLOSED | 12/09/11 | 12/08/12 | mat747 | 2 |
Knotfind on | CLOSED | 12/10/11 | 12/31/11 | beta_helix | 6 |
Cancer Puzzle | CLOSED | 12/11/11 | 12/25/11 | EzraThexton | 1 |
Test Puzzle | CLOSED | 12/18/11 | 12/19/11 | kurenan | 1 |
SERPINB5 | CLOSED | 12/19/11 | 12/26/11 | Niubilism | 0 |
BLARG | CLOSED | 12/20/11 | 12/21/11 | Chappers | 0 |
BLARG | CLOSED | 12/20/11 | 12/21/11 | Chappers | 2 |
Montcrest | CLOSED | 12/20/11 | 01/31/12 | Chappers | 3 |
Montcrest for real | CLOSED | 12/20/11 | 01/31/12 | Chappers | 1 |
Montcrest | CLOSED | 12/20/11 | 01/31/12 | Chappers | 1 |
HIV | CLOSED | 12/20/11 | 01/31/12 | Chappers | 7 |
hjjjjjjjjjjjjjjjjjj | CLOSED | 12/20/11 | 12/31/14 | oxyi | 1 |
my freestyle trial | CLOSED | 12/20/11 | 12/27/11 | Niubilism | 1 |
Small partial Tspan peptide | CLOSED | 12/21/11 | 12/31/11 | rwarn | 1 |
variable freestlye design | CLOSED | 12/21/11 | 12/31/11 | sum | 0 |
variable freestlye design | CLOSED | 12/21/11 | 12/31/11 | sum | 1 |
Freestyle Design | CLOSED | 12/24/11 | 12/31/11 | r4m3nn00dl3s | 0 |
jujujujujujujujujujujujujuj ujujujujujujujujujujujujujujujujujujujujujujuju | CLOSED | 12/24/11 | 12/31/14 | oxyi | 1 |
Quick & Dirty KnotFind | CLOSED | 12/25/11 | 01/03/12 | Vincero | 1 |
Spielwiese - HIV Protease | CLOSED | 12/25/11 | 03/31/12 | Bithalbierer | 7 |
Spielwiese - Freestyle Design (Variable Length) | CLOSED | 12/25/11 | 03/31/12 | Bithalbierer | 4 |
Test Protein | CLOSED | 12/26/11 | 03/31/12 | kurenan | 1 |
vroom | CLOSED | 01/02/12 | 01/28/12 | kasmol | 1 |
Can you foldit? | CLOSED | 01/03/12 | 04/20/12 | S-Man | 0 |
CC | CLOSED | 01/05/12 | 01/07/12 | obson | 0 |
test | CLOSED | 01/12/12 | 01/31/12 | gurimmer | 0 |
test | CLOSED | 01/12/12 | 01/31/12 | gurimmer | 1 |
phospholipase A2 from mamushi snake venom | CLOSED | 01/11/12 | 01/26/12 | gurimmer | 0 |
Test test | CLOSED | 01/06/12 | 01/13/12 | smfuchs | 1 |
Can you win? | CLOSED | 01/06/12 | 01/07/12 | thekidsglenn7 | 1 |
HIV | CLOSED | 01/07/12 | 02/11/12 | fallenspartan | 1 |
prova | CLOSED | 01/08/12 | 01/17/12 | hu74go | 1 |
Freedom | CLOSED | 01/07/12 | 01/09/12 | qbolt500 | 0 |
FANTASY | CLOSED | 01/09/12 | 01/10/12 | hu74go | 1 |
begginer | CLOSED | 01/10/12 | 01/19/12 | bobbyjoejr | 0 |
Freestyle!!! | CLOSED | 01/11/12 | 01/12/12 | adele21 | 0 |
seal myoglobin | CLOSED | 01/13/12 | 01/31/12 | sum | 1 |
seal myoglobin | CLOSED | 01/13/12 | 01/31/12 | sum | 0 |
HIV protease | CLOSED | 01/16/12 | 01/17/12 | recondite7 | 0 |
HIV protease | CLOSED | 01/16/12 | 01/20/12 | recondite7 | 2 |
Degradation of Wood! Lets understand methane and CO2 production! | CLOSED | 01/21/12 | 09/30/12 | losWEEDos | 1 |
HIV Protease | CLOSED | 01/21/12 | 03/03/12 | recondite7 | 159 |
Hexaguin's Freestyle 80 | CLOSED | 01/22/12 | 01/31/12 | hexaguin | 1 |
myoglobin | CLOSED | 01/22/12 | 01/26/12 | vacmar | 1 |
Bioc WSC | CLOSED | 03/06/12 | 03/08/12 | jcnichols | 27 |
HIV protease | CLOSED | 01/25/12 | 01/31/12 | docfon | 1 |
Bioc_670_2 | CLOSED | 01/26/12 | 02/10/12 | bkuhlman | 1 |
bioc_3 | CLOSED | 01/26/12 | 02/14/12 | bkuhlman | 18 |
Bioc_670_Protease | CLOSED | 01/26/12 | 02/10/12 | bkuhlman | 1 |
Just For Fun | CLOSED | 01/26/12 | 01/27/12 | Metadryad | 1 |
Some Test Contest | CLOSED | 01/26/12 | 02/05/12 | Biology-EtcManager | 2 |
Random | CLOSED | 01/28/12 | 01/31/12 | dabanks | 1 |
Trying something out :) pardon | CLOSED | 01/31/12 | 02/29/12 | PeptideMuncher | 1 |
Theoredoxin | CLOSED | 01/31/12 | 01/31/14 | PeptideMuncher | 1 |
Testdudetest | CLOSED | 01/31/12 | 02/29/12 | testdudetest | 1 |
CRAC | CLOSED | 01/31/12 | 02/23/12 | testdudetest | 1 |
Freestyle Design 80 | CLOSED | 01/31/12 | 02/09/12 | kimdn | 1 |
test-contest | CLOSED | 02/01/12 | 02/02/12 | climax141 | 1 |
chemchem111 | CLOSED | 02/01/12 | 02/02/12 | nlite510 | 1 |
Moloney Murine Leukaemia Virus Matrix Protein | CLOSED | 02/01/12 | 02/03/12 | beta_helix | 4 |
H3 Hemagglutinin Flu Design Puzzle | CLOSED | 02/01/12 | 02/03/12 | beta_helix | 4 |
leukaemia virus chain native matrix | CLOSED | 02/01/12 | 08/27/12 | GoshaDole | 1 |
bioc_670_design | CLOSED | 02/01/12 | 02/15/12 | bkuhlman | 19 |
Holotoxin | CLOSED | 02/03/12 | 02/06/12 | Erik.dover | 0 |
Biology-NanogContest | CLOSED | 02/03/12 | 02/29/12 | Seth Cooper | 99 |
Sandbox1 | CLOSED | 02/03/12 | 02/29/12 | nlite510 | 1 |
Sim-based Lifecycle Engineering | CLOSED | 02/29/12 | 03/31/12 | mxynidis | 1 |
Bio 152EC | CLOSED | 02/06/12 | 02/16/12 | smfuchs | 1 |
Freestyle Design: Variable Length | CLOSED | 05/02/13 | 05/10/13 | ligandfinder | 1 |
Adelphi FHB Design | CLOSED | 05/02/13 | 05/12/13 | ligandfinder | 6 |
BIo152 EC | CLOSED | 02/07/12 | 02/16/12 | smfuchs | 1 |
erero7 challenge | CLOSED | 02/08/12 | 02/29/12 | erero7 | 0 |
erero7 challenge | CLOSED | 02/08/12 | 02/29/12 | erero7 | 0 |
erero7 challenge | CLOSED | 02/08/12 | 02/29/12 | erero7 | 0 |
erero7 challenge | CLOSED | 02/08/12 | 02/29/12 | erero7 | 1 |
Test Puzzle to Fix Client | CLOSED | 02/08/12 | 02/29/12 | beta_helix | 23 |
design your own protein | CLOSED | 02/13/12 | 02/14/14 | mberna00 | 1 |
more thunk testing | CLOSED | 03/29/12 | 06/30/12 | anthunk | 9 |
Moloney Murine Leukaemia Virus Matrix Protein | CLOSED | 02/14/12 | 05/15/12 | Ch Garnier | 29 |
khfchlk 1 | CLOSED | 02/23/12 | 02/24/12 | Solenopsis invicta | 1 |
CLEAN ME!!!!!!!!!!!!!!!!! | CLOSED | 02/17/12 | 02/18/12 | Bjamin | 1 |
cyrusi's challange | CLOSED | 02/17/12 | 01/01/15 | cyrusi | 0 |
hi | CLOSED | 02/17/12 | 02/29/12 | cyrusi | 1 |
Halorhodopsin | CLOSED | 02/18/12 | 02/26/12 | MnSOD | 0 |
hi2 | CLOSED | 02/18/12 | 03/01/12 | cyrusi | 1 |
CASP Training | CLOSED | 02/18/12 | 04/30/12 | nealk | 1 |
C21ECL | CLOSED | 02/21/12 | 02/25/12 | lijiahua1984 | 1 |
C21ECL-1 | CLOSED | 02/21/12 | 02/24/12 | lijiahua1984 | 1 |
love vs. love | CLOSED | 02/22/12 | 02/24/12 | k.love | 2 |
Test contest | CLOSED | 02/23/12 | 02/23/13 | f1pokerspeed | 1 |
vroom2 | CLOSED | 02/24/12 | 03/24/12 | kasmol | 2 |
Test2 | CLOSED | 02/23/12 | 02/23/13 | 9ct29 | 1 |
GTPase Ras test | CLOSED | 02/29/12 | 04/30/12 | oshirikajirimushi18th | 1 |
HIV protease test | CLOSED | 03/01/12 | 05/01/12 | oshirikajirimushi18th | 1 |
Tspan peptide 2 | CLOSED | 03/03/12 | 04/01/12 | rwarn | 1 |
HIV Protease | CLOSED | 03/05/12 | 03/01/13 | dbuske | 1 |
Bioc WSC EC | CLOSED | 03/06/12 | 03/07/12 | jcnichols | 1 |
Nanog Homeobox Protein (NANOG) | CLOSED | 03/07/12 | 03/07/13 | Ch Garnier | 34 |
Monooxygenase | CLOSED | 03/10/12 | 04/30/12 | hansfoldit | 0 |
test | CLOSED | 03/11/12 | 03/12/12 | RedVenom | 1 |
Yu's lab C2E1 | CLOSED | 03/11/12 | 03/01/15 | lijiahua1984 | 1 |
Just playing around | CLOSED | 03/13/12 | 03/20/12 | wdherndon | 1 |
test | CLOSED | 03/13/12 | 03/20/12 | mk18 | 1 |
For my students | CLOSED | 03/16/12 | 03/23/12 | GirichMS | 1 |
blabla | CLOSED | 03/17/12 | 03/24/12 | ccilia | 1 |
Freestyle 20 | CLOSED | 03/17/12 | 03/20/12 | upquark | 1 |
For students | CLOSED | 03/18/12 | 04/30/12 | GirichMS | 1 |
For stud. 2 | CLOSED | 03/18/12 | 04/30/12 | GirichMS | 1 |
For stud. 3 | CLOSED | 03/18/12 | 04/30/12 | GirichMS | 1 |
This freestyle puzzle | CLOSED | 03/18/12 | 04/30/12 | GirichMS | 1 |
No. 4. | CLOSED | 03/18/12 | 04/30/12 | GirichMS | 1 |
No. 5 | CLOSED | 03/18/12 | 04/30/12 | GirichMS | 1 |
No. 6 | CLOSED | 03/18/12 | 04/30/12 | GirichMS | 1 |
ligan practice -open to all | CLOSED | 03/21/12 | 03/31/12 | Mike Tate | 3 |
Mat test | CLOSED | 03/20/12 | 03/20/13 | mat747 | 1 |
Bioc WSC EC | CLOSED | 03/25/12 | 03/31/12 | jcnichols | 27 |
first time | CLOSED | 03/24/12 | 03/25/12 | billyhuegel | 1 |
good luck | CLOSED | 03/24/12 | 03/25/12 | billyhuegel | 1 |
dont worry | CLOSED | 03/24/12 | 03/29/12 | billyhuegel | 0 |
Cancer Treatment Contest | CLOSED | 03/24/12 | 04/24/12 | DaVinci21 | 1 |
Freestyle Design 80 | CLOSED | 03/24/12 | 09/30/12 | ofc2000 | 1 |
artificial muscle | CLOSED | 03/25/12 | 03/31/12 | AkimotoYuki | 0 |
Lastest contest against the cancer | CLOSED | 03/30/12 | 12/31/15 | Dj-P | 105 |
clamp test | CLOSED | 03/30/12 | 03/31/12 | hilaryar | 1 |
Cameron | CLOSED | 04/03/12 | 04/04/12 | Cameron Baxendale | 0 |
Cameron | CLOSED | 04/03/12 | 04/04/12 | Cameron Baxendale | 1 |
TFS dwewf | CLOSED | 04/03/12 | 04/04/12 | jperoff | 2 |
Acyl Hydrolase | CLOSED | 04/03/12 | 04/04/12 | MichaelGasse | 1 |
Foamy Virus Gag protein | CLOSED | 04/10/12 | 04/17/12 | blutjoghurt | 1 |
BioClass | CLOSED | 04/11/12 | 04/15/12 | sarahod23 | 1 |
Human Respiratory Syncytial Virus Attachment Protein (RSV G) | CLOSED | 04/12/12 | 07/31/12 | MiCu | 1 |
HIV test | CLOSED | 04/11/12 | 04/13/12 | SciShowFTW | 1 |
(Closed) PEP Private Contest II | CLOSED | 04/12/12 | 04/18/12 | prolylendopeptidase | 4 |
(Closed) PEP Private Contest III | CLOSED | 05/22/12 | 05/31/12 | prolylendopeptidase | 3 |
Go freestyle! | CLOSED | 04/15/12 | 04/22/12 | AsDawnBreaks | 1 |
Test | CLOSED | 04/21/12 | 06/14/13 | paulsen | 0 |
Freestyle Design 500 | CLOSED | 04/16/12 | 04/29/12 | drumpeter18yrs9yrs | 2 |
test | CLOSED | 04/16/12 | 04/22/12 | test_account1 | 41 |
PFV Gag | CLOSED | 04/17/12 | 07/17/12 | blutjoghurt | 1 |
BHS - Nanog Contest | CLOSED | 04/24/12 | 05/12/12 | katievh | 125 |
Dana_Nicolo | CLOSED | 04/17/12 | 04/18/12 | dananumber13 | 3 |
DcmB | CLOSED | 04/18/12 | 07/13/12 | shadowwalk | 0 |
Long links | CLOSED | 04/21/12 | 04/30/12 | AsDawnBreaks | 6 |
Freestyle Design | CLOSED | 04/22/12 | 04/30/14 | michaeldee | 1 |
40 Segment Chain | CLOSED | 04/22/12 | 04/30/14 | michaeldee | 1 |
contest | CLOSED | 04/22/12 | 04/24/12 | yesir | 2 |
Protein Contest | CLOSED | 04/25/12 | 12/31/12 | Dave Levine | 0 |
Tiroler Nacht der Forschung | CLOSED | 04/25/12 | 04/29/12 | obiwan | 1 |
Tiroler Nacht der Forschung 2 | CLOSED | 04/25/12 | 04/29/12 | obiwan | 1 |
Let's go!!!! | CLOSED | 04/28/12 | 12/12/12 | wendy_rupnow | 0 |
Let's go!!!! | CLOSED | 04/28/12 | 12/12/12 | wendy_rupnow | 0 |
Blarghs contest | CLOSED | 04/30/12 | 12/31/12 | blargh123 | 1 |
LPDF Contest | CLOSED | 04/30/12 | 05/03/12 | maxionwimps | 1 |
[DEPRECATED] GTPase Ras long run *Anyone can join!* | CLOSED | 01/28/14 | 12/31/15 | AsDawnBreaks | 128 |
GOVST BIOCHEMISTRY | CLOSED | 05/07/12 | 12/17/12 | govstbiochem | 1 |
sample | CLOSED | 05/08/12 | 05/22/12 | govstbiochem | 0 |
rc013 | CLOSED | 05/09/12 | 05/31/12 | jlmaccal | 1 |
HIV stinks.... yeah yeah | CLOSED | 05/12/12 | 05/01/14 | tweak64 | 1 |
contest de foldit | CLOSED | 05/15/12 | 05/18/12 | Alakazam Einstein | 2 |
80 and everyone | CLOSED | 05/15/12 | 12/31/12 | Alakazam Einstein | 73 |
Marcus | CLOSED | 05/17/12 | 05/20/12 | mdaquino | 1 |
test test | CLOSED | 05/19/12 | 05/20/12 | Stolaf | 1 |
Ael | CLOSED | 05/20/12 | 06/03/12 | Aralys | 1 |
Knots | CLOSED | 05/22/12 | 05/23/12 | AsDawnBreaks | 1 |
Common Immunogenic Substrate (Fragment) | CLOSED | 05/23/12 | 06/30/12 | scooper14 | 3 |
33mer From Shan et. al. | CLOSED | 05/23/12 | 06/30/12 | scooper14 | 2 |
13-mer toxic peptides | CLOSED | 05/23/12 | 05/31/12 | hanhnguyen14 | 1 |
SEAL MYOGLOBIN | CLOSED | 05/25/12 | 11/25/12 | Ch Garnier | 19 |
Serine Proline Rich AfCNA | CLOSED | 05/25/12 | 06/28/12 | cookie2004 | 1 |
DSSP algorithm vs NR data base | CLOSED | 05/29/12 | 06/29/12 | BitSpawn | 6 |
Wolfer's Class | CLOSED | 05/31/12 | 06/06/12 | NTWII | 4 |
Wolfer's Class 2 | CLOSED | 05/31/12 | 06/06/12 | NTWII | 1 |
Test field 1 | CLOSED | 06/01/12 | 06/02/12 | phi16 | 1 |
No Peeking - Immediately drag puzzle off screen when beginning. Players should NEVER see the protein. | CLOSED | 06/01/12 | 06/30/12 | phi16 | 46 |
tester | CLOSED | 06/01/12 | 06/02/12 | CharlieFortsConscience | 2 |
Transmembrane Molecule Modelling | CLOSED | 06/01/12 | 06/30/12 | Beerwing | 1 |
Testing puzzle | CLOSED | 06/03/12 | 10/03/12 | Ch Garnier | 6 |
SAC Summer 2012 OChem Challenge | CLOSED | 06/04/12 | 06/10/12 | brian.parker | 24 |
N-GlnR | CLOSED | 06/09/12 | 09/30/12 | weihuachen5211 | 1 |
Homology Modeling Course: HIV Protease | CLOSED | 06/12/12 | 06/15/12 | obiwan | 7 |
SarNorA | CLOSED | 06/12/12 | 07/12/12 | docsaro | 1 |
Test Protein | CLOSED | 06/12/12 | 06/12/13 | kurenan | 1 |
Kumamolisin | CLOSED | 06/13/12 | 07/31/15 | drummerdude204 | 1 |
Trm7 | CLOSED | 06/14/12 | 06/21/12 | v0lfg0ng | 1 |
Test | CLOSED | 06/15/12 | 06/16/12 | xDust | 0 |
Design Space | CLOSED | 06/15/12 | 06/21/14 | drummerdude204 | 80 |
Design it | CLOSED | 06/15/12 | 06/21/14 | DustWitch | 1 |
CASP9 Target 611 residue protein | CLOSED | 06/18/12 | 06/18/13 | meatexplosion | 2 |
Freestyle Design 40: For Learning LUA | CLOSED | 06/24/12 | 06/30/15 | gitwut.lua | 1 |
Everyone Join! | CLOSED | 06/28/12 | 12/24/13 | lakeyja900 | 130 |
coolkids2 contest | CLOSED | 07/06/12 | 07/07/12 | meelock | 1 |
coolkids2 contest | CLOSED | 07/06/12 | 07/07/12 | meelock | 0 |
the testing puzzle! | CLOSED | 07/09/12 | 08/31/12 | drumpeter18yrs9yrs | 0 |
HIV protease | CLOSED | 07/09/12 | 07/31/12 | drumpeter18yrs9yrs | 0 |
Toxic Gluten Molecule | CLOSED | 07/11/12 | 07/29/12 | scooper14 | 6 |
Toxic Gluten Peptide | CLOSED | 07/11/12 | 07/29/12 | scooper14 | 6 |
Just 4 fun | CLOSED | 07/12/12 | 07/20/12 | Josephdud66 | 1 |
intracellular Caspase-Modulating Chimeric Antigen Receptor | CLOSED | 07/17/12 | 07/17/14 | starone | 0 |
Yes | CLOSED | 07/24/12 | 07/25/12 | JBrown2322 | 2 |
Sugar Binding Puzzle | CLOSED | 07/24/12 | 07/30/12 | beta_helix | 6 |
biocon | CLOSED | 07/26/12 | 07/27/12 | aurabum | 1 |
Contest | CLOSED | 07/30/12 | 07/31/12 | Nicbudd77 | 0 |
test asdfg | CLOSED | 07/31/12 | 08/02/12 | Asbiorn | 0 |
extended_design_tj | CLOSED | 08/02/12 | 08/05/12 | TJBrunette | 1 |
A london Olympic contest! | CLOSED | 08/05/12 | 08/12/12 | junh821 | 4 |
Beginner HIV protease | CLOSED | 08/07/12 | 08/10/12 | rarkenin | 1 |
SHELL | CLOSED | 08/09/12 | 08/08/13 | chingsong | 0 |
test | CLOSED | 08/09/12 | 08/09/13 | chingsong | 0 |
Big Win | CLOSED | 08/14/12 | 12/31/15 | alexlan | 0 |
Freestyle | CLOSED | 08/16/12 | 08/30/12 | Mytherus | 1 |
500 residue freestyle! | CLOSED | 08/16/12 | 08/20/14 | meatexplosion | 3 |
Beat it! | CLOSED | 08/17/12 | 08/18/12 | Quinton830 | 0 |
d o | CLOSED | 08/23/12 | 08/23/15 | Joanna Staite | 0 |
zhustb | CLOSED | 08/26/12 | 08/25/13 | chingsong | 1 |
Varriable Freestyle | CLOSED | 08/30/12 | 09/30/12 | Dishrat006 | 0 |
virus | CLOSED | 09/02/12 | 12/28/12 | Aqua817 | 1 |
Just for test | CLOSED | 09/06/12 | 09/07/12 | dyh | 1 |
the protein | CLOSED | 09/07/12 | 09/26/15 | river12345 | 1 |
working in a mutate script | CLOSED | 09/07/12 | 09/01/13 | BitSpawn | 1 |
Open 500 Segment design puzzle | CLOSED | 09/09/12 | 12/31/15 | Ryanfav | 49 |
My first contest | CLOSED | 09/14/12 | 09/30/12 | SOARcdur | 1 |
GTPase pas puzzle | CLOSED | 09/14/12 | 12/31/12 | SOARcdur | 1 |
you betta win | CLOSED | 09/19/12 | 09/23/12 | SOARcmoo | 1 |
Š²ŃŠµ наГоемо | CLOSED | 09/24/12 | 09/30/12 | egik1997 | 1 |
l2pmike | CLOSED | 09/24/12 | 09/25/12 | OppaProteinStyleZ | 0 |
l2pmike | CLOSED | 09/24/12 | 09/25/12 | OppaProteinStyleZ | 0 |
freestyle fun | CLOSED | 09/26/12 | 12/31/12 | saggyballs | 1 |
Clayton Biochemistry Fall 12 | CLOSED | 09/30/12 | 12/01/12 | rsingiser | 17 |
40 aa class test | CLOSED | 09/27/12 | 12/01/12 | rsingiser | 1 |
Entamoeba insertion domain | CLOSED | 10/06/12 | 10/12/13 | lucnoken | 1 |
Rod | CLOSED | 10/08/12 | 10/09/12 | Rodrigo999 | 0 |
Rodrigo | CLOSED | 10/08/12 | 10/16/15 | Rodrigo999 | 1 |
Freestyle | CLOSED | 10/08/12 | 10/07/13 | asdf9 | 8 |
Flu Puzzle Competition | CLOSED | 10/09/12 | 10/11/12 | beta_helix | 28 |
Cancer Puzzle | CLOSED | 10/09/12 | 10/11/12 | beta_helix | 1 |
Malaria Puzzle | CLOSED | 10/09/12 | 10/11/12 | beta_helix | 3 |
Flu Puzzle | CLOSED | 10/09/12 | 10/11/12 | beta_helix | 3 |
Bioc F12 EC#1 | CLOSED | 10/11/12 | 10/15/12 | jcnichols | 30 |
Freestyle design 40 | CLOSED | 10/09/12 | 10/09/14 | meatexplosion | 1 |
Freestyle design 20 | CLOSED | 10/09/12 | 10/09/14 | meatexplosion | 1 |
test for M-SBVfCT | CLOSED | 10/12/12 | 10/13/12 | tjbertram | 0 |
test of SmfT0743fCT | CLOSED | 10/12/12 | 10/13/12 | tjbertram | 0 |
Trichoplusia ni. Gloverin Protein | CLOSED | 10/12/12 | 12/31/13 | ainstein001 | 1 |
Multi-Start Bacteroides Vulgatus Contest | CLOSED | 10/13/12 | 04/13/13 | Ch Garnier | 17 |
Server models for T0743 Contest | CLOSED | 10/13/12 | 05/13/13 | Ch Garnier | 12 |
Penn State Hershey BMS 504 | CLOSED | 10/15/12 | 10/28/12 | iropson | 1 |
Penn State Hershey BMS 504 Contest 2 | CLOSED | 10/15/12 | 10/28/12 | iropson | 27 |
Bioc EC #2 | CLOSED | 10/16/12 | 10/17/12 | jcnichols | 18 |
Frizzled Design Puzzle Contest - October PD | CLOSED | 10/25/12 | 11/01/12 | katievh | 1 |
Kenny | CLOSED | 10/26/12 | 01/01/13 | kennyhill | 0 |
freestyle test | CLOSED | 10/27/12 | 10/28/12 | Marek_Berlin | 1 |
Metallothionein | CLOSED | 11/05/12 | 11/30/12 | Phil.Pa | 1 |
Test Scripting - ZKora | CLOSED | 11/08/12 | 11/30/12 | ZKora | 1 |
Albert | CLOSED | 11/13/12 | 11/14/12 | Albert_tanjaya | 2 |
AP Bio Puzzle 1 | CLOSED | 11/15/12 | 11/18/12 | APTeach235 | 1 |
design | CLOSED | 11/22/12 | 12/31/13 | smart guy | 0 |
Design 40 | CLOSED | 11/17/12 | 12/17/12 | clptrsn | 1 |
FUN! FUN! | CLOSED | 11/17/12 | 11/30/15 | alexkarate | 0 |
Freestyle Design 500 | CLOSED | 11/21/12 | 11/22/12 | Daileyc | 0 |
hahhaaha cool. | CLOSED | 11/19/12 | 11/23/12 | joshlitchman | 1 |
marolidas sandbox | CLOSED | 11/20/12 | 11/27/12 | marolidas | 1 |
fire and rain | CLOSED | 11/20/12 | 12/22/12 | mattymoe | 1 |
fire and rain | CLOSED | 11/20/12 | 12/22/12 | mattymoe | 1 |
Black Nest of doom | CLOSED | 11/23/12 | 12/31/12 | mattymoe | 0 |
Black Nest of doom | CLOSED | 11/23/12 | 12/31/12 | mattymoe | 1 |
Black Nest of Doom | CLOSED | 11/23/12 | 12/31/12 | mattymoe | 2 |
GTPase Ras | CLOSED | 11/23/12 | 12/28/12 | ridesisapis | 0 |
Script testing | CLOSED | 11/23/12 | 12/31/15 | Jean-Bob | 11 |
fold it contest | CLOSED | 11/29/12 | 11/30/12 | ylecroy | 2 |
Frizzle | CLOSED | 12/02/12 | 03/02/13 | marie_s | 1 |
Streptococcus pneumoniae | CLOSED | 12/02/12 | 12/31/12 | Placebo | 1 |
Streptococcus pneumoniae 80 | CLOSED | 12/02/12 | 12/31/12 | Placebo | 1 |
>R0023 SP18154A, Streptococcus pneumoniae, 100 residues MRAQSFFLTFSFIRSKIKLALNKGVLNMIEITYIDASKNERTVTFESYEDFERSQQACLI GVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN | CLOSED | 12/02/12 | 12/10/12 | margo311 | 1 |
lms friends | CLOSED | 12/03/12 | 12/04/12 | johncb3 | 0 |
Monkeys Rock Ham jhhh hhhhhhhhh | CLOSED | 12/04/12 | 12/30/12 | NathanGotSkills23 | 0 |
Everyone can join | CLOSED | 12/03/12 | 01/16/13 | junikl2 | 1 |
HIV | CLOSED | 12/05/12 | 12/29/12 | Quxwozing | 1 |
cancer help | CLOSED | 12/06/12 | 12/31/13 | jordansapp1 | 2 |
Test 123 | CLOSED | 12/07/12 | 12/14/12 | RicGray | 1 |
Spielwiese Freestyle Design 40 | CLOSED | 12/08/12 | 12/31/13 | Bithalbierer | 1 |
bioinformatic task for exam | CLOSED | 12/09/12 | 12/20/12 | margo311 | 0 |
bioinformatic task for exam | CLOSED | 12/09/12 | 12/20/12 | margo311 | 0 |
bioinformatic task for exam | CLOSED | 12/09/12 | 12/20/12 | margo311 | 1 |
100 amino acids | CLOSED | 12/09/12 | 12/20/12 | margo311 | 0 |
100 amino acids | CLOSED | 12/09/12 | 12/20/12 | margo311 | 1 |
>R0023 SP18154A, Streptococcus pneumoniae, 100 residues | CLOSED | 12/09/12 | 12/25/12 | margo311 | 1 |
Second part | CLOSED | 12/10/12 | 12/24/12 | Placebo | 1 |
Easy Contest | CLOSED | 12/12/12 | 12/30/12 | haywick | 0 |
Bio152 | CLOSED | 12/13/12 | 01/31/13 | smfuchs | 1 |
Fastest person | CLOSED | 12/13/12 | 12/22/12 | ponies_rock | 1 |
DR.B JWU BIOCHEM | CLOSED | 12/19/12 | 02/10/13 | drmbudziszek | 0 |
FTN1438 | CLOSED | 12/19/12 | 12/31/13 | nwabu1ao | 1 |
11 | CLOSED | 12/20/12 | 01/29/13 | ScottNDean | 1 |
Membrane receptor | CLOSED | 12/20/12 | 02/28/13 | ScottNDean | 1 |
Other receptor | CLOSED | 12/20/12 | 12/14/13 | ScottNDean | 1 |
go with the flow | CLOSED | 12/23/12 | 12/30/12 | Npereira | 1 |
Go with the flow 2 | CLOSED | 12/23/12 | 12/30/12 | Npereira | 1 |
Stop The HIV Protease | CLOSED | 12/28/12 | 12/31/12 | Evaesion | 1 |
evaesion | CLOSED | 12/28/12 | 12/31/12 | Evaesion | 0 |
Anyone can join, HIV Protease, OPEN TO ALL | CLOSED | 01/06/13 | 02/10/13 | Phillipthegreat | 34 |
ww domain | CLOSED | 01/08/13 | 01/31/13 | deans | 2 |
DR.B JWU BIOCHEM Contest-HIV protease | CLOSED | 01/08/13 | 02/17/13 | drmbudziszek | 7 |
Testing Group Contests | CLOSED | 01/09/13 | 01/10/13 | auntdeen | 0 |
Freestyle Design (80 segments) | CLOSED | 01/13/13 | 01/31/14 | OrigamiMaster | 1 |
Testing Puzzle | CLOSED | 01/15/13 | 01/31/13 | thoyt2012 | 1 |
HIV protease - BIOL225 | CLOSED | 01/16/14 | 01/22/14 | Kimbostu | 6 |
Mad hatter | CLOSED | 01/17/13 | 01/18/13 | EmperorSupreme | 0 |
feqf | CLOSED | 01/21/13 | 01/17/15 | jinguluninja | 1 |
Tau Protein (441 residue htau40) | CLOSED | 01/23/13 | 12/31/16 | jinguluninja | 1 |
test | CLOSED | 01/24/13 | 01/01/14 | sonneys | 1 |
Frizzled Design because we are bored | CLOSED | 01/24/13 | 01/27/13 | jamiexq | 17 |
Two Day Beat Back the Boredom Puzzle | CLOSED | 01/24/13 | 01/26/13 | auntdeen | 14 |
Another Beat Back the Boredom Old Style | CLOSED | 01/24/13 | 01/26/13 | auntdeen | 19 |
3 day speed folding | CLOSED | 01/24/13 | 01/27/13 | jamiexq | 15 |
ferer gerge | CLOSED | 01/27/13 | 01/13/16 | jinguluninja | 1 |
80 segment freestyle design. 1 month. | CLOSED | 01/29/13 | 02/28/13 | MurloW | 10 |
THE OCTAGON v2 | CLOSED | 02/07/13 | 02/08/13 | nomatic | 1 |
LASA Octagon | CLOSED | 02/07/13 | 02/10/13 | JosephOleniczak | 0 |
gtpase ras | CLOSED | 02/09/13 | 02/01/15 | jjwinkle4740 | 1 |
Drosophila Melanogaster nmd protein AAA superfamily | CLOSED | 02/09/13 | 02/08/14 | jjwinkle4740 | 1 |
nmd AAA ATPase | CLOSED | 02/09/13 | 02/08/14 | jjwinkle4740 | 9 |
Educurious Frizzled Design Puzzle Contest! | CLOSED | 02/10/13 | 03/31/13 | katievh | 51 |
vgsetgethgtr rgwethg | CLOSED | 02/14/13 | 02/14/16 | oxyi | 1 |
scritterTest | CLOSED | 02/15/13 | 02/28/13 | scritter | 1 |
scritterTest2 | CLOSED | 02/15/13 | 02/28/13 | scritter | 1 |
Bio chem assignment | CLOSED | 02/16/13 | 02/15/14 | sonneys | 0 |
biochem assignment | CLOSED | 02/16/13 | 02/15/14 | sonneys | 1 |
WSU Bioc (S13) | CLOSED | 02/18/13 | 02/20/13 | jcnichols | 37 |
Chicken Noodle Soup | CLOSED | 02/17/13 | 06/22/13 | mattymoe | 1 |
Tbf1 | CLOSED | 02/20/13 | 07/17/13 | Rivsie | 1 |
BCHS3201 | CLOSED | 02/20/13 | 02/25/13 | fahdkabani | 3 |
fahdkabani | CLOSED | 02/20/13 | 02/21/13 | fahdkabani | 2 |
Clayton Biochemistry Spring 13 | CLOSED | 02/25/13 | 05/05/13 | rsingiser | 25 |
Freestyle Variable Length. 1 month. | CLOSED | 02/26/13 | 03/25/13 | MurloW | 8 |
Bioc S13 2nd chance | CLOSED | 02/26/13 | 02/28/13 | jcnichols | 1 |
Bioc 2nd chance (S13) | CLOSED | 02/28/13 | 03/02/13 | jcnichols | 3 |
HansDampf | CLOSED | 02/28/13 | 05/03/13 | Wilm | 0 |
EL3 #2 | CLOSED | 03/01/13 | 05/03/13 | Wilm | 0 |
thing | CLOSED | 03/03/13 | 03/04/13 | erek | 1 |
pechi demo | CLOSED | 03/03/13 | 06/07/13 | anthunk | 2 |
Biokemi contest | CLOSED | 03/05/13 | 03/06/13 | MagnusA | 1 |
HIV protease | CLOSED | 03/05/13 | 03/26/13 | alex809010 | 0 |
Elijahs contest | CLOSED | 03/08/13 | 03/31/13 | ilikediamonds | 2 |
Test | CLOSED | 03/09/13 | 07/20/13 | mind_hack | 1 |
HBV core protein | CLOSED | 03/14/13 | 03/15/13 | Tsogo | 0 |
HBV core protein | CLOSED | 03/14/13 | 03/23/13 | Tsogo | 1 |
A Battle in Design | CLOSED | 03/14/13 | 03/14/14 | TheEnderCavalier | 0 |
Contest | CLOSED | 03/16/13 | 03/31/13 | dallinac | 0 |
Contest | CLOSED | 03/17/13 | 03/18/13 | CardsOverCoins | 1 |
ISHMIT DAHAL | CLOSED | 03/18/13 | 03/19/13 | USER2013 | 1 |
ricgtest | CLOSED | 03/18/13 | 03/24/13 | RicGray | 0 |
UCDS Test Contest | CLOSED | 03/25/13 | 04/30/13 | UCDS_Test | 3 |
For testing purposes | CLOSED | 03/19/13 | 03/31/13 | f00barbob | 1 |
a test of rich disordered seq | CLOSED | 03/19/13 | 03/31/13 | wangxinyu_cn | 1 |
The Fountain of Youth | CLOSED | 03/20/13 | 03/31/16 | deinfrank | 0 |
Frizzled | CLOSED | 03/21/13 | 03/23/13 | beta_helix | 1 |
40 segment Freestyle Design. 2 weeks. | CLOSED | 03/22/13 | 04/06/13 | MurloW | 3 |
SMIM1 | CLOSED | 03/24/13 | 03/31/13 | gestur | 3 |
3G | CLOSED | 03/25/13 | 04/30/13 | rvalensia | 1 |
Test 2 | CLOSED | 03/25/13 | 04/30/13 | RicGray | 0 |
Moar Freestyle Design. 80 seg, 1 week | CLOSED | 03/26/13 | 04/02/13 | MurloW | 2 |
Super Freestyle | CLOSED | 03/27/13 | 04/27/13 | super_Nethergirl | 1 |
Super Freestyle | CLOSED | 03/27/13 | 04/27/13 | super_Nethergirl | 1 |
Biotech WFB 1 | CLOSED | 03/28/13 | 04/09/13 | KBrown | 2 |
Biotech WFB HIV | CLOSED | 03/28/13 | 04/09/13 | KBrown | 0 |
UCDS April Contest | CLOSED | 04/01/13 | 04/30/13 | UCDS_A0 | 24 |
hmm | CLOSED | 04/07/13 | 04/09/13 | MurloW | 1 |
Wisks Contest | CLOSED | 04/06/13 | 04/30/13 | WiskIRC | 2 |
hm | CLOSED | 04/07/13 | 04/09/13 | MurloW | 1 |
Freestyle Design Variable Length. 2 weeks | CLOSED | 04/09/13 | 04/24/13 | MurloW | 1 |
Multi-domain protein | CLOSED | 04/10/13 | 07/10/13 | pbartlow | 1 |
First molecule | CLOSED | 04/12/13 | 04/13/13 | gsandoval | 1 |
Freestyle Design 80 | CLOSED | 04/13/13 | 04/20/13 | JamesLeCornu | 0 |
Freestyle 80 segment de-novo | CLOSED | 04/22/13 | 04/27/13 | wosser1 | 1 |
Vandeweyer_Protein | CLOSED | 04/22/13 | 04/30/13 | gvandeweyer | 1 |
5cDraw Gutstopen | CLOSED | 04/22/13 | 04/27/13 | ManVsYard | 1 |
P22-N | CLOSED | 04/23/13 | 04/27/13 | syoifczeri | 1 |
P22-N^W[Tb] | CLOSED | 04/23/13 | 04/30/13 | syoifczeri | 1 |
the great vacation raceoff | CLOSED | 06/01/13 | 09/30/13 | shadow345 | 0 |
Join if u Dare | CLOSED | 04/26/13 | 04/20/14 | srgp2012 | 5 |
2 weeks, 80 segment design. | CLOSED | 04/27/13 | 05/11/13 | MurloW | 4 |
Freestyle Design 80 | CLOSED | 05/03/13 | 05/18/13 | iqbalmahmud | 1 |
Small Hepatitis B Surface Antigen (HBsAg) | CLOSED | 05/07/13 | 05/07/14 | bigben446 | 1 |
Test | CLOSED | 05/12/13 | 05/17/13 | MurloW | 1 |
testing own script | CLOSED | 05/13/13 | 12/31/16 | Morus | 1 |
Family and Friends | CLOSED | 05/13/13 | 05/07/16 | LunarEclipse | 1 |
GTPase Ras | CLOSED | 05/15/13 | 05/31/13 | Ninty9 | 0 |
The Final Model | CLOSED | 05/15/13 | 05/16/13 | WheeDhee | 8 |
ricg contest | CLOSED | 05/17/13 | 05/18/13 | RicGray | 1 |
peptide test | CLOSED | 05/31/13 | 05/17/14 | syoifczeri | 1 |
LOX enzyme from human | CLOSED | 05/21/13 | 12/24/13 | magnus groes | 1 |
Reinhardt Demo stuff | CLOSED | 06/04/13 | 06/18/13 | ReinhardtScience | 1 |
ScienceTeacherTresting | CLOSED | 06/04/13 | 06/18/13 | ReinhardtScience | 0 |
scienceteach test wee | CLOSED | 06/04/13 | 06/18/13 | ReinhardtScience | 1 |
FOlditExpo | CLOSED | 06/06/13 | 06/11/13 | ReinhardtScience1 | 1 |
CASPtraining | CLOSED | 06/10/13 | 06/30/13 | Linux_Penguin | 0 |
protein desgin | CLOSED | 06/11/13 | 06/14/13 | ctdevlin | 1 |
59 chain protein | CLOSED | 06/12/13 | 06/30/13 | ctdevlin | 1 |
Start of Sumer HIV | CLOSED | 06/19/13 | 06/26/13 | nerdysib | 1 |
GTPase Ras | CLOSED | 06/19/13 | 07/20/13 | ChinaSESsolve | 1 |
PitA | CLOSED | 07/16/13 | 08/10/13 | canthony9 | 1 |
Sorry, This is test | CLOSED | 06/27/13 | 06/28/13 | myputer | 1 |
prueba mioglobina | CLOSED | 06/30/13 | 06/11/14 | cmendo | 1 |
Just a puzzle | CLOSED | 07/01/13 | 07/31/13 | wisky | 1 |
Clayton Biochemistry Summer 13 | CLOSED | 07/03/13 | 07/24/13 | rsingiser | 15 |
test | CLOSED | 07/04/13 | 07/05/13 | Raphsup | 4 |
Sup'BioFold | CLOSED | 07/04/13 | 07/05/13 | Darksliver | 4 |
e235wef | CLOSED | 07/07/13 | 07/23/16 | phallicies | 1 |
Highest score | CLOSED | 07/07/13 | 12/25/13 | dbuske | 0 |
sup | CLOSED | 07/09/13 | 07/10/13 | bionano1 | 0 |
YneM | CLOSED | 07/10/13 | 08/17/13 | canthony9 | 1 |
De-Extinction! | CLOSED | 07/10/13 | 07/31/13 | gordon_wade | 0 |
Acad Alignment Puzle | CLOSED | 07/11/13 | 07/11/14 | thomasjs223 | 1 |
Freestyle Design 40 | CLOSED | 07/12/13 | 07/12/16 | Sadler | 1 |
Beginner Alignment Puzzle Sup'Biotech | CLOSED | 07/12/13 | 07/13/13 | Darksliver | 3 |
Freestyle Design 20 | CLOSED | 07/12/13 | 07/12/16 | Sadler | 1 |
UNC SHARP Contest 1 | CLOSED | 07/12/13 | 07/31/13 | jetaiken | 3 |
UNC SHARP Contest 2 | CLOSED | 07/12/13 | 07/31/13 | Sharp3 | 0 |
UNC SHARP Contest 2 | CLOSED | 07/12/13 | 07/31/13 | jetaiken | 1 |
Virus Matrix | CLOSED | 07/15/13 | 08/15/13 | dbuske | 1 |
Test | CLOSED | 07/28/13 | 07/31/13 | violinist67 | 0 |
PfTLP | CLOSED | 07/16/13 | 07/16/14 | BNGSTE001 | 1 |
Curing_Mad_Diseases_Bro | CLOSED | 07/17/13 | 09/01/13 | Cyren_Guerrero | 1 |
testcol4a3bp | CLOSED | 07/18/13 | 12/19/13 | G_H_B | 0 |
testcol4a3bp2 | CLOSED | 07/18/13 | 12/19/13 | G_H_B | 1 |
Adam & Tyler | CLOSED | 07/20/13 | 07/23/13 | Adamdejesus | 1 |
Adam & Tyler | CLOSED | 07/20/13 | 07/23/13 | Adamdejesus | 2 |
indoor soccer shoes adidas f50 | CLOSED | 07/24/13 | 07/26/13 | Clarisonic123 | 0 |
Free test | CLOSED | 07/29/13 | 08/23/13 | eatfears | 1 |
how to make unknownyytw | CLOSED | 07/29/13 | 07/31/13 | chinatsu | 1 |
i-motif DNA structure | CLOSED | 08/01/13 | 08/31/13 | csjonline | 0 |
Debugger | CLOSED | 08/05/13 | 08/11/13 | Tadasu | 1 |
Science aids | CLOSED | 08/09/13 | 08/12/13 | sience geek | 2 |
test | CLOSED | 08/19/13 | 08/21/13 | bkoep | 1 |
design test | CLOSED | 08/19/13 | 08/21/13 | bkoep | 1 |
Frizztest | CLOSED | 08/20/13 | 08/31/13 | spmm | 1 |
Pace Academy 2014 HIV protease | CLOSED | 08/21/13 | 12/21/13 | thattori | 37 |
Investigate Inspect Test | CLOSED | 08/20/13 | 08/21/13 | NickyCGS | 3 |
200 Residue Freestyle! | CLOSED | 08/21/13 | 08/21/14 | meatexplosion | 44 |
Small Dimer | CLOSED | 08/22/13 | 08/29/13 | spdenne | 1 |
Solve for Treatment | CLOSED | 08/30/13 | 09/10/13 | PirateX12 | 2 |
SK SK | CLOSED | 09/01/13 | 12/31/16 | ScratchKid | 1 |
SK SK | CLOSED | 09/01/13 | 12/31/16 | ScratchKid | 2 |
1 week Freestyle 80seg Trimer Design | CLOSED | 08/30/13 | 09/06/13 | MurloW | 2 |
HIV Protease | CLOSED | 09/01/13 | 09/28/13 | Gamerrr111 | 0 |
Spider silk design | CLOSED | 09/01/13 | 12/31/16 | Jirachi | 1 |
test dimer | CLOSED | 09/03/13 | 09/06/13 | jsorr | 1 |
Aptamers 1 | CLOSED | 09/04/13 | 12/31/13 | Aiursfallen | 1 |
BIIN351_1 | CLOSED | 09/04/13 | 09/18/13 | ash | 2 |
McCallie AP Biology | CLOSED | 09/07/13 | 09/11/13 | mccallieapbiology | 0 |
HIV | CLOSED | 09/15/13 | 09/29/13 | trueplayer | 0 |
Freestyle Design 80 | CLOSED | 09/15/13 | 09/15/20 | Sadler | 1 |
NEAR contest | CLOSED | 09/27/13 | 09/29/13 | nyla12 | 1 |
battle royal | CLOSED | 09/17/13 | 09/19/13 | delay | 0 |
Small test protein | CLOSED | 09/17/13 | 12/31/13 | wudoo | 1 |
Small test protein 2 | CLOSED | 09/17/13 | 12/31/13 | wudoo | 1 |
yahya | CLOSED | 09/17/13 | 01/13/16 | yahyamohammed | 0 |
Test your PC power | CLOSED | 12/03/13 | 09/30/16 | Bruno Kestemont | 59 |
silk protein | CLOSED | 09/22/13 | 09/13/14 | danielgcc | 1 |
HIV | CLOSED | 09/26/13 | 09/24/16 | ScoobyHusky | 1 |
ella introduction | CLOSED | 09/28/13 | 10/28/13 | manasa | 0 |
ELAV4_48_118 | CLOSED | 09/28/13 | 09/01/14 | Panoramix | 1 |
zekrom | CLOSED | 09/30/13 | 01/01/14 | canadajan | 0 |
dan shit | CLOSED | 10/05/13 | 10/06/13 | nosleevesforlife | 0 |
hiv positive | CLOSED | 10/03/13 | 10/04/13 | Mhembrough | 1 |
Triple Helix DNA | CLOSED | 10/03/13 | 10/31/15 | Tovi | 1 |
Sandbox | CLOSED | 10/05/13 | 10/19/13 | creteen | 1 |
Trying to make a Propeller! | CLOSED | 10/08/13 | 10/31/13 | wisky | 1 |
GPCR Test | CLOSED | 10/09/13 | 10/03/14 | alathb | 1 |
easy | CLOSED | 10/09/13 | 10/31/16 | alex90 | 0 |
easy | CLOSED | 10/09/13 | 12/31/16 | alex90 | 1 |
Lab Sequence | CLOSED | 10/16/13 | 10/01/14 | Orangeutan | 1 |
Open Design Test | CLOSED | 10/18/13 | 10/19/13 | picklion | 1 |
Come and Play | CLOSED | 10/31/13 | 10/22/16 | roxyroxy | 0 |
Private Contest | CLOSED | 10/21/13 | 10/23/13 | theOMGmonster | 0 |
Extra credit for exam | CLOSED | 10/23/13 | 10/31/13 | jcnichols | 37 |
progesterone reductase | CLOSED | 10/25/13 | 10/25/14 | sarahoconnor | 0 |
Contest | CLOSED | 10/25/13 | 10/27/13 | DDarling | 2 |
utaca | CLOSED | 10/25/13 | 11/15/16 | utaca | 1 |
DAYDER VIRTUALIZATION | CLOSED | 10/30/13 | 10/20/14 | Roman Rozin | 0 |
MPI | CLOSED | 10/31/13 | 11/30/13 | Mengzzz | 19 |
My first contest)) | CLOSED | 11/01/13 | 11/07/13 | krytoy1 | 0 |
Design test | CLOSED | 11/01/13 | 11/30/13 | wisky | 1 |
Beginner Alignment Puzzle | CLOSED | 11/03/13 | 11/30/13 | Chris123 | 1 |
Valentine's day | CLOSED | 11/06/13 | 02/14/14 | Compassionate | 1 |
Test Contest | CLOSED | 11/06/13 | 01/31/14 | Roukess | 1 |
test2 | CLOSED | 11/06/13 | 01/31/14 | Roukess | 1 |
GTPase Ras | CLOSED | 11/10/13 | 11/10/14 | MyFines | 0 |
fun | CLOSED | 11/21/13 | 12/31/16 | ninjaeliot | 1 |
Yo dawg | CLOSED | 11/25/13 | 11/30/13 | HelloKittyIslandAdventure | 1 |
Obliged to try that! | CLOSED | 12/01/13 | 02/28/14 | Gabs_the_lil_protein | 1 |
IVa2 | CLOSED | 11/03/14 | 12/20/14 | paul.kascak | 1 |
IVa2 | CLOSED | 11/14/14 | 11/30/14 | paul.kascak | 1 |
IVa2 | CLOSED | 11/23/14 | 11/07/15 | paul.kascak | 1 |
sang contesy | CLOSED | 11/30/13 | 12/09/13 | swl2013 | 1 |
what is this??? | CLOSED | 12/02/13 | 12/05/13 | Niiikola | 2 |
free style 101 | CLOSED | 12/02/13 | 12/25/13 | Jaceno | 9 |
The Marathon of Foldit: 611 residues big puzzle chalenge | CLOSED | 12/03/13 | 12/02/16 | Bruno Kestemont | 22 |
Client Tests | CLOSED | 12/04/13 | 12/31/16 | Matthew Krueger | 28 |
stress responsive protein [Porphyromonas gingivalis SJD2] | CLOSED | 12/06/13 | 12/12/14 | DashaDv | 1 |
Ligand Practice | CLOSED | 12/07/13 | 12/16/13 | slofgren | 1 |
40 freestyle | CLOSED | 12/09/13 | 12/05/16 | DashaDv | 1 |
dimer test | CLOSED | 12/09/13 | 12/15/16 | syoifczeri | 1 |
Fight AIDS | CLOSED | 12/09/13 | 12/31/16 | Matthew Krueger | 290 |
Freestyle Design a 500 length Protein! | CLOSED | 12/09/13 | 12/31/16 | Matthew Krueger | 43 |
Total freedom | CLOSED | 12/09/13 | 12/10/13 | ahaddad | 1 |
Protein Laboratory | CLOSED | 12/10/13 | 12/25/13 | slofgren | 1 |
trimer test | CLOSED | 12/11/13 | 12/31/15 | syoifczeri | 1 |
Whatever You Want | CLOSED | 12/20/13 | 12/21/13 | The Super Cat | 0 |
Polite | CLOSED | 12/21/13 | 04/25/14 | Spark5 | 2 |
manners | CLOSED | 12/21/13 | 02/28/14 | Spark5 | 1 |
ABCDEFG HIJK | CLOSED | 12/21/13 | 01/05/14 | Spark5 | 1 |
Test 611 | CLOSED | 12/27/13 | 12/28/13 | NickyCGS | 1 |
Trimer design | CLOSED | 12/28/13 | 12/28/14 | arivero | 1 |
popopop | CLOSED | 12/28/13 | 12/31/13 | swl2013 | 1 |
Testing ground 3 | CLOSED | 12/30/13 | 12/30/14 | slofgren | 1 |
testing Foldit minimize split intein 3NZM | CLOSED | 01/02/14 | 01/02/16 | sagearbor | 2 |
Create-a-Protein I | CLOSED | 01/04/14 | 01/11/14 | PennyfromHeaven | 1 |
SaLLIa666 Game | CLOSED | 01/08/14 | 01/12/14 | SaLLIa666 | 1 |
AIDS ATTACK | CLOSED | 01/08/14 | 12/31/17 | Luciana | 1 |
Sparky | CLOSED | 01/09/14 | 03/09/14 | Spark6 | 1 |
carlos | CLOSED | 01/18/14 | 01/19/14 | phillida | 1 |
carlos | CLOSED | 01/10/14 | 01/11/14 | bharani94 | 2 |
Urena | CLOSED | 01/11/14 | 01/12/14 | robertito | 1 |
owen | CLOSED | 01/13/14 | 01/20/14 | owen9o930 | 0 |
MGC 2014 | CLOSED | 01/16/14 | 01/22/14 | Kimbostu | 1 |
BIOL225 2014 | CLOSED | 01/16/14 | 01/22/14 | Kimbostu | 9 |
My 500 Test | CLOSED | 01/17/14 | 02/24/14 | BCAA | 1 |
missing side chains | CLOSED | 01/24/14 | 02/23/14 | apoma | 0 |
Wulff's Fantastic Core Challenge | CLOSED | 01/27/14 | 02/28/14 | -Jacoby- | 12 |
GTPase Ras Long b [Open to all] [Open discussion] | CLOSED | 01/28/14 | 12/31/17 | AsDawnBreaks | 169 |
Golden Goose | CLOSED | 01/29/14 | 01/30/14 | Maverik_Goose | 0 |
R3 | CLOSED | 01/29/14 | 01/30/14 | maverickandgoose | 1 |
Red Block 2 | The Foldit Games | CLOSED | 01/30/14 | 02/07/14 | xXF4T3D_P4R4D0Xx | 6 |
The Marathon of Foldit - New Chapter | CLOSED | 02/01/14 | 02/28/17 | Bruno Kestemont | 126 |
Funny | CLOSED | 02/01/14 | 04/06/14 | Spark6 | 1 |
test arla | CLOSED | 02/07/14 | 02/14/14 | arlap | 1 |
test arla 2 | CLOSED | 02/07/14 | 02/14/14 | arlap | 1 |
test arla 3 | CLOSED | 02/07/14 | 02/14/14 | arlap | 0 |
test | CLOSED | 02/12/14 | 02/13/14 | l_like | 2 |
ligand test | CLOSED | 02/13/14 | 02/12/15 | syoifczeri | 1 |
Test1212 | CLOSED | 02/14/14 | 02/15/14 | NickyCGS | 1 |
Test1313 | CLOSED | 02/14/14 | 02/15/14 | NickyCGS | 1 |
Test contest | CLOSED | 02/14/14 | 02/15/14 | NickyCGS | 1 |
D | CLOSED | 02/17/14 | 02/24/14 | MurloW | 1 |
Mean, lean, crumple machine | CLOSED | 02/20/14 | 06/22/14 | mind_hack | 1 |
Clayton Biochemistry Spring 2014 | CLOSED | 02/24/14 | 05/01/14 | rsingiser | 11 |
mutate_test | CLOSED | 02/25/14 | 04/25/14 | robgee | 1 |
1 | CLOSED | 02/26/14 | 02/27/14 | egilleh | 1 |
jhdfksaufsahkmd | CLOSED | 02/28/14 | 03/02/14 | spider876 | 2 |
Test | CLOSED | 03/03/14 | 03/05/14 | PeerPride | 1 |
Trest | CLOSED | 03/02/14 | 03/13/14 | PeerPride | 1 |
Test | CLOSED | 03/03/14 | 03/13/14 | PeerPride | 0 |
Seal Myoglobin | CLOSED | 03/03/14 | 03/09/14 | PeerPride | 0 |
drim | CLOSED | 03/05/14 | 03/06/14 | emulhall | 0 |
Freestyle Design 100 Sandbox | CLOSED | 03/06/14 | 03/31/17 | viosca | 1 |
AntProtFly | CLOSED | 03/06/14 | 03/05/15 | Flagg65a | 1 |
AntProtFly2 | CLOSED | 03/06/14 | 03/05/15 | Flagg65a | 1 |
Raf kinase inhibitor | CLOSED | 03/07/14 | 03/30/14 | pongoo | 1 |
Biol. 312 project | CLOSED | 03/10/14 | 04/29/14 | Claire_Rinehart | 1 |
Freestyle 40 | CLOSED | 03/13/14 | 03/14/14 | Shpooom | 1 |
IQS protein folding contest 2014 | CLOSED | 03/17/14 | 03/31/14 | xevi.biarnes | 1 |
Freestyle Design 80 | CLOSED | 03/19/14 | 03/20/14 | thoyt2012 | 1 |
test20 | CLOSED | 03/20/14 | 03/20/17 | Jean-Bob | 1 |
De Novo Folding of Auts2 | CLOSED | 03/24/14 | 06/24/14 | ACastanza | 1 |
lost points test case | CLOSED | 03/26/14 | 12/25/14 | brgreening | 1 |
HIV protease | CLOSED | 03/27/14 | 04/04/14 | Professor West | 11 |
Test32714 | CLOSED | 03/27/14 | 03/28/14 | NickyCGS | 1 |
Testmarch2714 | CLOSED | 03/27/14 | 03/28/14 | NickyCGS | 1 |
Test 327 | CLOSED | 03/27/14 | 03/28/14 | NickyCGS | 1 |
test 80 trimer 327 | CLOSED | 03/27/14 | 03/28/14 | NickyCGS | 2 |
Test Contest 327 | CLOSED | 03/27/14 | 03/28/14 | NickyCGS | 1 |
702 | CLOSED | 04/01/14 | 06/29/14 | csqu001 | 1 |
702 | CLOSED | 04/01/14 | 06/01/14 | csqu001 | 1 |
Freestyle Symmetric Design: 40 Dimer | CLOSED | 04/04/14 | 04/11/14 | test_account1 | 0 |
Freestyle Symmetric Design: 40 Trimer | CLOSED | 04/04/14 | 04/11/14 | test_account1 | 0 |
Freestyle Symmetric Design: 80 Dimer | CLOSED | 04/04/14 | 04/11/14 | test_account1 | 0 |
Freestyle Symmetric Design: 80 Trimer | CLOSED | 04/04/14 | 04/11/14 | test_account1 | 0 |
40-2 | CLOSED | 04/09/14 | 04/16/14 | test_account1 | 2 |
40-3 | CLOSED | 04/09/14 | 04/16/14 | test_account1 | 2 |
80-2 | CLOSED | 04/09/14 | 04/16/14 | test_account1 | 1 |
80-3 | CLOSED | 04/09/14 | 04/16/14 | test_account1 | 1 |
500 for intermediate and beginning players | CLOSED | 04/15/14 | 04/29/14 | Andres186000@gmail.com | 1 |
Freestyle DC | CLOSED | 04/23/14 | 05/28/14 | spearandmagichelmet | 1 |
vlp de filette | CLOSED | 04/23/14 | 05/31/14 | alexram99 | 1 |
Sup'bio02 | CLOSED | 04/24/14 | 04/27/14 | isaa54 | 12 |
Supbiotech A | CLOSED | 04/24/14 | 04/25/14 | ChloeAudrey | 10 |
Butt | CLOSED | 04/24/14 | 04/25/14 | dlaplaca | 1 |
test | CLOSED | 04/25/14 | 04/26/14 | kasper42 | 1 |
lost points test two | CLOSED | 04/25/14 | 04/25/17 | brgreening | 1 |
Test 42514 | CLOSED | 04/25/14 | 04/26/14 | NickyCGS | 1 |
design DNA? | CLOSED | 04/29/14 | 04/30/16 | kibakabul | 1 |
Biostructure Contest | CLOSED | 05/07/14 | 05/08/14 | Komsomolez | 7 |
Amazing | CLOSED | 05/13/14 | 05/18/14 | Botanix | 0 |
Test, festyn bibs | CLOSED | 05/15/14 | 05/19/14 | Behoston | 2 |
Dino contest | CLOSED | 05/14/14 | 05/15/14 | isabelfer | 2 |
test frizzled | CLOSED | 05/16/14 | 05/17/14 | Seth Cooper | 1 |
Frizzled test | CLOSED | 05/16/14 | 05/24/14 | fankong | 1 |
test nanog | CLOSED | 05/16/14 | 05/17/14 | Seth Cooper | 1 |
test abeta | CLOSED | 05/16/14 | 05/17/14 | Seth Cooper | 1 |
test abeta 2 | CLOSED | 05/16/14 | 05/17/14 | Seth Cooper | 1 |
indi 500 segment race | CLOSED | 05/17/14 | 12/31/17 | jeshprabakaran | 1 |
the | CLOSED | 05/19/14 | 05/20/14 | HAI-YU CHENG | 1 |
Foldit tura pierwsza | CLOSED | 05/23/14 | 05/25/14 | Behoston | 17 |
Test design | CLOSED | 05/29/14 | 05/30/14 | Valectar | 1 |
Testing200 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST1 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST2 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST3 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST4 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST5 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST6 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST7 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST8 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST9 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST10 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST11 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST12 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST13 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST14 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST15 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST16 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST17 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST18 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST19 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST20 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
ConTEST21 | CLOSED | 05/30/14 | 05/31/14 | NickyCGS | 1 |
Abeta Binder Piecewise Design | CLOSED | 05/30/14 | 06/21/14 | fankong | 2 |
test test 12345 | CLOSED | 06/04/14 | 06/05/14 | Seth Cooper | 0 |
new test | CLOSED | 06/03/14 | 06/04/14 | test_account1 | 1 |
Freestyle VarLength | CLOSED | 06/08/14 | 06/30/14 | Bithalbierer | 1 |
Myoglobin | CLOSED | 06/08/14 | 06/15/14 | Bithalbierer | 1 |
test100 | CLOSED | 06/10/14 | 06/11/14 | Seth Cooper | 1 |
test150 | CLOSED | 06/10/14 | 06/11/14 | Seth Cooper | 1 |
test200 | CLOSED | 06/10/14 | 06/11/14 | Seth Cooper | 1 |
Fight Liver Cancer | CLOSED | 06/12/14 | 12/31/14 | retroneo | 1 |
prejudice on HIV | CLOSED | 06/13/14 | 12/16/14 | manasa | 1 |
Test Dimer | CLOSED | 06/30/14 | 07/28/14 | jflat06 | 1 |
Test Trimer | CLOSED | 06/30/14 | 07/28/14 | jflat06 | 1 |
DrCBDmon | CLOSED | 06/15/14 | 06/30/14 | angenentmari | 1 |
test nanog | CLOSED | 06/17/14 | 06/18/14 | test_account1 | 1 |
lilovip01 | CLOSED | 06/22/14 | 07/22/14 | lilovip | 1 |
Sandboxing, private pls | CLOSED | 07/04/14 | 07/04/15 | Thardus | 1 |
Abeta contest CampBIOmed | CLOSED | 07/09/14 | 07/11/14 | kaurg | 3 |
Nanog Transcription Factor Contest - CampBIOmed | CLOSED | 07/15/14 | 07/16/14 | kaurg | 10 |
Abeta protein CampBIOmed | CLOSED | 07/15/14 | 07/20/14 | kaurg | 7 |
nanog | CLOSED | 07/17/14 | 07/24/14 | oli-popxD | 1 |
frezae | CLOSED | 07/18/14 | 08/31/14 | frezae | 0 |
:P Fold it | CLOSED | 07/25/14 | 08/09/14 | I-Love-Computers | 1 |
hankg10 | CLOSED | 07/28/14 | 07/29/14 | hankg10 | 1 |
AZV 1 | CLOSED | 07/28/14 | 08/09/14 | azvolpe | 1 |
Nanog Transcription factor contest | CLOSED | 07/29/14 | 07/31/14 | kaurg | 3 |
ABETA PROTEIN COMPETITION | CLOSED | 07/29/14 | 08/01/14 | kaurg | 4 |
20 amino acid-- protein | CLOSED | 08/06/14 | 08/24/14 | Barbaramoshi | 0 |
Immunoglobulin D Hinge H1 | CLOSED | 08/06/14 | 08/17/14 | frogzorz | 0 |
Camp BIOmed NANOG contest | CLOSED | 08/11/14 | 08/13/14 | kaurg24 | 6 |
Amyloid Beta contest - CampBIOmed | CLOSED | 08/12/14 | 08/14/14 | kaurg24 | 6 |
Cux1 p110 Cleavage Domain, 440-753 | CLOSED | 08/12/14 | 08/19/14 | antoine777 | 1 |
Test | CLOSED | 08/12/14 | 08/13/14 | antoine777 | 1 |
figure it out | CLOSED | 08/14/14 | 08/18/14 | crush2112 | 1 |
HIV | CLOSED | 08/15/14 | 06/30/15 | Test Lab | 1 |
Freestyle design 40 pc | CLOSED | 08/17/14 | 09/17/14 | Serraglio | 0 |
thiinngyyy cathole | CLOSED | 08/19/14 | 08/31/14 | aguy77 | 0 |
The National Protein Test | CLOSED | 08/22/14 | 08/29/14 | azak2002 | 1 |
bZIP | CLOSED | 08/28/14 | 09/18/14 | sven1103 | 1 |
test | CLOSED | 09/27/14 | 06/25/15 | srettie | 1 |
Small Peptides | CLOSED | 09/27/14 | 11/30/14 | Bautho | 1 |
Stefano Fuschetto | CLOSED | 09/30/14 | 07/22/16 | Stefano Fuschetto | 0 |
Flute lets go son | CLOSED | 09/30/14 | 10/01/14 | FluteJasonKarakaedos | 3 |
test | CLOSED | 10/01/14 | 10/01/15 | Orcus | 1 |
AMES #1 experement | CLOSED | 10/07/14 | 10/31/14 | foldase555 | 1 |
AMES Science fair made me do it | CLOSED | 10/07/14 | 10/31/14 | foldase555 | 1 |
foldit pro | CLOSED | 10/08/14 | 10/09/14 | otterballer | 1 |
show your protein | CLOSED | 10/10/14 | 10/30/14 | Hydromaker107 | 0 |
vanabin | CLOSED | 10/10/14 | 10/11/14 | polli8 | 1 |
Putative Plant Protein | CLOSED | 10/10/14 | 10/31/14 | Mecklenburger Friese | 1 |
Miso: a critical protein for mosquito reproduction | CLOSED | 10/14/14 | 10/01/16 | asmidler | 1 |
Miso try 2 | CLOSED | 10/14/14 | 10/01/17 | asmidler | 1 |
FirstTry | CLOSED | 10/15/14 | 10/17/14 | Waverka.10 | 2 |
MedChem14 | CLOSED | 10/16/14 | 10/27/14 | pedrofong | 3 |
Atg1 Protein | CLOSED | 10/17/14 | 12/31/14 | Mecklenburger Friese | 1 |
Hypotethical Protein ATU0225 | CLOSED | 10/21/14 | 10/09/15 | gorrila13 | 1 |
A#1284 | CLOSED | 10/22/14 | 11/30/14 | Liam0289 | 1 |
Bioc EC Fall 2014 | CLOSED | 10/28/14 | 11/15/14 | jcnichols | 32 |
testing | CLOSED | 10/31/14 | 11/01/14 | ipcfg | 1 |
yo | CLOSED | 10/31/14 | 11/01/14 | otterballer | 1 |
Biotek Esp | CLOSED | 11/04/14 | 11/11/14 | Henriksk | 1 |
C4lab-Friendly Contest | CLOSED | 11/04/14 | 11/23/14 | yi-an Tung | 7 |
New_contest | CLOSED | 11/07/14 | 12/09/14 | pedrofong | 0 |
New_contest | CLOSED | 11/07/14 | 12/09/14 | pedrofong | 14 |
test test | CLOSED | 11/08/14 | 11/30/14 | obiwan | 0 |
test test | CLOSED | 11/10/14 | 11/30/14 | obiwan | 0 |
Best Design | CLOSED | 11/09/14 | 11/30/14 | David_M1231 | 0 |
zincfingers | CLOSED | 11/20/14 | 02/18/15 | chingsong2 | 1 |
coursework | CLOSED | 11/20/14 | 12/31/14 | chingsong | 27 |
course work test | CLOSED | 11/21/14 | 12/31/14 | chingsong | 1 |
TFP | CLOSED | 11/21/14 | 12/31/14 | chingsong2 | 1 |
test 80 segment | CLOSED | 11/23/14 | 11/26/15 | brgreening | 1 |
80 Segments Each | CLOSED | 11/24/14 | 12/23/14 | ElliottB1 | 1 |
Test Post Please Ignore | CLOSED | 11/24/14 | 11/25/14 | rjking01 | 0 |
SH3PX1 | CLOSED | 11/25/14 | 02/28/15 | Patrick1116 | 0 |
SH3PX1 | CLOSED | 11/25/14 | 02/28/15 | Patrick1116 | 0 |
SH3PX1 | CLOSED | 11/25/14 | 02/28/15 | Patrick1116 | 1 |
SH3PX1 | CLOSED | 11/25/14 | 02/28/15 | Patrick1116 | 0 |
SH3PX1 | CLOSED | 11/25/14 | 02/28/15 | Patrick1116 | 0 |
TFP200 | CLOSED | 11/25/14 | 12/31/14 | chingsong2 | 2 |
design test | CLOSED | 11/27/14 | 11/30/15 | ipcfg | 1 |
First puzzle | CLOSED | 11/29/14 | 12/03/14 | r.gore | 1 |
dimer a-helix coiled-coil | CLOSED | 11/29/14 | 12/05/14 | r.gore | 1 |
Frizzled Design Contest | CLOSED | 11/30/14 | 12/06/14 | ingoneato | 14 |
Biophysical chemistry workshop University of Edinburgh Test | CLOSED | 12/19/14 | 12/03/15 | jmichel80 | 16 |
Design_test | CLOSED | 12/03/14 | 12/04/14 | bkoep | 2 |
RevDimer | CLOSED | 12/04/14 | 12/05/14 | Tanamura | 1 |
HIV protease contest | CLOSED | 12/04/14 | 12/07/14 | DrewNyeTheScienceGuy | 0 |
conTest | CLOSED | 12/04/14 | 12/12/14 | jflat06 | 1 |
conTest2 | CLOSED | 12/04/14 | 12/12/14 | jflat06 | 1 |
BIOC530 | CLOSED | 12/04/14 | 12/12/14 | bkoep | 46 |
Small test 20 segment | CLOSED | 12/05/14 | 12/01/15 | aninweton | 1 |
small test variable length | CLOSED | 12/05/14 | 12/05/15 | aninweton | 1 |
Hiv | CLOSED | 12/07/14 | 12/01/15 | dbuske | 4 |
helix | CLOSED | 12/09/14 | 12/31/15 | ivalnic | 1 |
test | CLOSED | 12/11/14 | 12/12/14 | Bloch_Party | 1 |
test | CLOSED | 12/12/14 | 12/13/14 | bkoep | 1 |
Best holiday design | CLOSED | 12/21/14 | 12/31/14 | Skippysk8s | 8 |
I Dare You!!! | CLOSED | 01/09/15 | 01/10/15 | nakul_0702 | 0 |
Come at me Bro | CLOSED | 01/08/15 | 01/12/15 | GentlestElm29 | 0 |
Lets have fun | CLOSED | 01/11/15 | 01/13/15 | imenm | 3 |
my bioinfo assinment | CLOSED | 01/17/15 | 02/12/15 | c0d3w4rri0r | 1 |
my bio info assinment version 2 | CLOSED | 01/17/15 | 02/01/15 | c0d3w4rri0r | 1 |
HIV Protease - BIOL225 | CLOSED | 01/22/15 | 01/29/15 | Siderhurst | 11 |
Make a Greek Key | CLOSED | 01/27/15 | 02/10/15 | jakelmer | 0 |
x | CLOSED | 01/22/15 | 02/18/15 | jakelmer | 1 |
Greek Key Challenge | CLOSED | 01/25/15 | 02/10/15 | jakelmer | 12 |
Freestyle Design 40 | CLOSED | 01/27/15 | 01/31/18 | HerobrinesArmy | 1 |
Freestyle Design 20 | CLOSED | 01/27/15 | 01/31/18 | HerobrinesArmy | 1 |
Freestyle Design 40 | CLOSED | 01/30/15 | 12/31/15 | Hutty | 1 |
Freestyle150 | CLOSED | 01/30/15 | 01/30/17 | queentut16 | 1 |
trial | CLOSED | 02/04/15 | 02/08/15 | jort | 1 |
normal contest | CLOSED | 02/04/15 | 02/05/15 | deephama001 | 1 |
the ice dragons playhouse | CLOSED | 02/06/15 | 02/28/15 | the ice dragon | 3 |
Fold It League Preseason Scrimmage | CLOSED | 02/06/15 | 02/14/15 | DGOVIL | 0 |
testmb | CLOSED | 02/10/15 | 02/12/15 | jakelmer | 1 |
test | CLOSED | 02/10/15 | 02/10/16 | silverberg | 3 |
Greek Key Test | CLOSED | 02/11/15 | 03/11/15 | kirkngrant | 1 |
Greek Key Test Run | CLOSED | 02/11/15 | 03/11/15 | kirkngrant | 0 |
You choose the number of residues | CLOSED | 02/11/15 | 02/28/18 | michaeldee | 20 |
Abeta Binder | CLOSED | 02/11/15 | 12/31/18 | michaeldee | 296 |
Nanog Transcription Factor | CLOSED | 02/11/15 | 12/31/18 | michaeldee | 81 |
Frizzled Design Puzzle Contest | CLOSED | 02/11/15 | 12/31/18 | michaeldee | 42 |
Testacular | CLOSED | 02/22/15 | 03/30/15 | HerobrinesArmy | 0 |
mTOR | CLOSED | 02/23/15 | 02/23/18 | kurenan | 1 |
freestyle 20 | CLOSED | 02/24/15 | 02/24/16 | manasa | 1 |
Porin | CLOSED | 02/27/15 | 03/02/15 | Jonathan51 | 1 |
Private Contest | CLOSED | 02/27/15 | 02/28/16 | babacon | 1 |
test | CLOSED | 03/03/15 | 03/04/15 | boltax | 1 |
block II test | CLOSED | 03/03/15 | 03/04/15 | boltax | 1 |
protein 3AB [Enterovirus C] | CLOSED | 03/08/15 | 05/08/15 | orangejayo1 | 1 |
Testing 150 | CLOSED | 03/09/15 | 03/27/15 | HerobrinesArmy | 1 |
HbA1 Test | CLOSED | 03/11/15 | 03/12/15 | minecraft4ever4 | 0 |
HBA1 Test | CLOSED | 03/11/15 | 03/13/15 | minecraft4ever4 | 1 |
HBA1 Test2 | CLOSED | 03/11/15 | 03/12/15 | minecraft4ever4 | 1 |
dyfhyh yghdrh | CLOSED | 03/11/15 | 03/15/15 | minecraft4ever4 | 1 |
G-quadruplex | CLOSED | 03/14/15 | 03/02/16 | kapick84 | 0 |
Seymoue | CLOSED | 03/16/15 | 03/19/15 | ChAda2015 | 0 |
Exam 2 EC Spring 2015 | CLOSED | 03/27/15 | 04/05/15 | jcnichols | 14 |
Greek Key V2.0 | CLOSED | 03/30/15 | 04/15/15 | jakelmer | 3 |
Coiled Helices | CLOSED | 03/30/15 | 04/04/15 | Bautho | 1 |
Freestyle Design 150 | CLOSED | 04/02/15 | 04/10/15 | spacexplorer | 1 |
D&A Mess | CLOSED | 04/28/15 | 07/12/15 | ChrisScientist | 0 |
HBM | CLOSED | 04/12/15 | 07/26/15 | ChrisScientist | 1 |
a | CLOSED | 04/06/15 | 04/14/15 | jinxed | 1 |
Michael | CLOSED | 04/26/15 | 04/28/16 | jinxed | 2 |
Test auto | CLOSED | 04/11/15 | 04/12/15 | wudoo | 0 |
linker | CLOSED | 04/11/15 | 04/30/15 | 463418196@qq.com | 1 |
killen | CLOSED | 04/23/15 | 04/24/15 | woops | 7 |
P98 | CLOSED | 04/23/15 | 04/30/16 | hphilipp | 1 |
aaa | CLOSED | 04/26/15 | 05/15/15 | mak3e | 1 |
Just For Begginers | CLOSED | 04/29/15 | 04/30/15 | timothyu120 | 1 |
cenpH | CLOSED | 05/07/15 | 08/07/15 | josephab | 1 |
Check Cartesian Bug | CLOSED | 05/11/15 | 06/30/15 | brgreening | 1 |
Helix | CLOSED | 05/13/15 | 05/15/15 | dendixon | 0 |
test 1111 | CLOSED | 05/15/15 | 12/31/15 | cyj101366 | 0 |
helix test | CLOSED | 05/18/15 | 05/27/15 | dendixon | 1 |
Hel | CLOSED | 05/19/15 | 05/19/19 | ivalnic | 1 |
BF Mol Dynamics | CLOSED | 05/22/15 | 05/25/15 | Ivelina Zaharieva | 7 |
Contest #1 | CLOSED | 05/30/15 | 05/30/16 | pizpot | 2 |
bioinf | CLOSED | 06/06/15 | 06/10/15 | 23RPE | 1 |
bioinf01 | CLOSED | 06/06/15 | 06/10/15 | 23RPE | 1 |
bioinf02 | CLOSED | 06/06/15 | 06/10/15 | 23RPE | 0 |
HIV protease BK | CLOSED | 06/10/15 | 06/11/15 | bkoep | 1 |
Freestyle Design 500 | CLOSED | 06/15/15 | 06/22/15 | pipos1 | 1 |
Folding con | CLOSED | 06/16/15 | 06/16/16 | zedOFF | 0 |
Test contest for a project at TU Clausthal | CLOSED | 06/20/15 | 06/21/18 | Shanschke | 1 |
GTPase Ras Fold | CLOSED | 06/25/15 | 07/01/15 | BlockheadXX | 0 |
Protein Folding with Point mutations | CLOSED | 07/28/15 | 06/16/18 | emernic | 1 |
Freestyle 500 | CLOSED | 06/30/15 | 06/15/18 | emernic | 1 |
Guanlin_HUST | CLOSED | 07/03/15 | 07/03/16 | Guanlinli | 1 |
Camp BIOmed 2015 Week1 | CLOSED | 07/06/15 | 07/10/15 | apklock | 5 |
Freestyle 40 | CLOSED | 07/07/15 | 07/08/15 | LKluke | 1 |
Quinoa Test | CLOSED | 07/09/15 | 07/31/15 | dinoboy11 | 1 |
freestyle | CLOSED | 07/11/15 | 09/30/15 | felix1998 | 0 |
Camp BIOmed 2015 Week2 | CLOSED | 07/13/15 | 07/17/15 | apklock | 5 |
Insulin | CLOSED | 07/14/15 | 07/18/15 | Unwise | 0 |
Here we go | CLOSED | 07/14/15 | 07/18/15 | Unwise | 1 |
Peptides to design | CLOSED | 07/26/15 | 01/01/16 | Brabrax | 0 |
Camp BIOmed week 4 | CLOSED | 07/27/15 | 07/31/15 | apklock | 6 |
Freestyle Design 40 | CLOSED | 07/28/15 | 08/01/15 | the wheat thin | 1 |
A4 test | CLOSED | 07/30/15 | 08/04/15 | rohtem | 1 |
46 Kris | CLOSED | 07/31/15 | 08/07/15 | kristoferkeiser | 0 |
Erv46 Kris | CLOSED | 07/31/15 | 08/07/15 | kristoferkeiser | 1 |
We are bored - Design Trimer Contest | CLOSED | 08/02/15 | 08/16/15 | jamiexq | 9 |
Week 5 Camp BIOmed | CLOSED | 08/03/15 | 08/07/15 | apklock | 6 |
Final Project | CLOSED | 08/04/15 | 08/31/15 | megskene | 1 |
lilovip-tests-02 | CLOSED | 08/05/15 | 08/31/18 | lilovip | 1 |
For Science | CLOSED | 08/07/15 | 09/30/15 | HDRH | 0 |
test | CLOSED | 08/13/15 | 08/14/15 | sungwon | 1 |
Trial | CLOSED | 08/17/15 | 08/20/15 | OlgaRadchuk | 1 |
Camp BIOmed 2015 Week 7 | CLOSED | 08/17/15 | 08/21/15 | apklock | 7 |
Duquesne PJAS 1 | CLOSED | 09/25/15 | 09/27/15 | pink_cupcakes | 9 |
Duquesne PJAS 2 | CLOSED | 09/25/15 | 09/27/15 | pink_cupcakes | 1 |
Duquesne PJAS 3 | CLOSED | 09/25/15 | 09/27/15 | pink_cupcakes | 1 |
Duq Test | CLOSED | 09/10/15 | 09/11/15 | pink_cupcakes | 1 |
Design 200 | CLOSED | 09/13/15 | 09/30/15 | TheFlagellum | 0 |
Oakwood Honors Bio Contest | CLOSED | 09/17/15 | 09/30/15 | elightrake | 1 |
Real Oakwood Honors Bio Contest | CLOSED | 09/17/15 | 09/30/15 | elightrake | 4 |
test 1 | CLOSED | 09/23/15 | 10/31/15 | honeypiebeatles | 1 |
Happier | CLOSED | 09/30/15 | 09/30/18 | ferricst8 | 1 |
AtuJ1E6-cpGFP | CLOSED | 10/01/15 | 10/31/18 | Lemons | 1 |
STD | CLOSED | 10/01/15 | 12/31/18 | Smellis | 0 |
Chem2208 | CLOSED | 10/02/15 | 10/03/15 | u5586300 | 2 |
Test DANIELLE | CLOSED | 10/04/15 | 10/17/15 | petetrig | 1 |
USTB work | CLOSED | 10/09/15 | 10/10/15 | chingsong | 1 |
GCN-4 Bipy | CLOSED | 10/14/15 | 10/16/15 | LiamMarshall | 0 |
Moe | CLOSED | 10/21/15 | 10/01/16 | ivalnic | 1 |
yoyoyo | CLOSED | 10/24/15 | 12/03/15 | Aria Deng | 2 |
AP BIO Pd. 3 | CLOSED | 10/28/15 | 11/03/15 | smuheisen1 | 0 |
chase | CLOSED | 10/28/15 | 10/29/15 | ChaseLehr1234 | 1 |
EC Fall15 | CLOSED | 10/30/15 | 11/15/15 | jcnichols | 1 |
EC Fall15 | CLOSED | 10/29/15 | 11/15/15 | jcnichols | 14 |
Test | CLOSED | 11/08/15 | 11/30/15 | Skulduggery | 1 |
test 2 | CLOSED | 11/09/15 | 12/25/15 | Skulduggery | 1 |
Yay! | CLOSED | 11/10/15 | 11/17/15 | code cat | 1 |
outer envelope protein 80 [Arabidopsis thaliana] | CLOSED | 11/12/15 | 01/05/16 | swimbug2014 | 0 |
outer envelope protein 80 [Arabidopsis thaliana] | CLOSED | 11/11/15 | 01/06/16 | swimbug2014 | 1 |
Freestyle 80 Trimer | CLOSED | 11/11/15 | 12/20/16 | AryehK | 1 |
easron | CLOSED | 11/16/15 | 11/17/15 | EastonSickels1234 | 2 |
SHS | CLOSED | 11/20/15 | 11/21/15 | fanerdbcshs | 4 |
Leishmania donovani Ornithine decarboxylase | CLOSED | 11/20/15 | 11/25/15 | mikroplasma | 2 |
Test | CLOSED | 11/23/15 | 11/24/15 | crostomily | 0 |
Test contest | CLOSED | 11/23/15 | 11/24/15 | seantan | 1 |
win or lose | CLOSED | 11/28/15 | 12/01/15 | spider876 | 0 |
3. y biometrix | CLOSED | 11/30/15 | 11/30/16 | blomsterman | 2 |
JJT twincombo | CLOSED | 11/30/15 | 01/31/16 | Canadian KId | 2 |
Practice Contest | CLOSED | 12/10/15 | 12/11/15 | crostomily | 8 |
test | CLOSED | 12/02/15 | 12/03/15 | seantan | 0 |
King of the Class | CLOSED | 12/10/15 | 12/11/15 | crostomily | 6 |
testing | CLOSED | 12/04/15 | 12/08/15 | vkalas | 1 |
invite only | CLOSED | 12/04/15 | 12/04/16 | vkalas | 1 |
SymmetryTest | CLOSED | 12/07/15 | 12/08/15 | Bautho | 1 |
PRACTICE TEST 1 | CLOSED | 12/08/15 | 12/09/15 | seantan | 3 |
PRACTICE TEST 2 | CLOSED | 12/08/15 | 12/09/15 | seantan | 3 |
Swaggy Folding | CLOSED | 12/10/15 | 12/15/15 | Atsnider | 0 |
DIY Protein (A Big One) | CLOSED | 12/11/15 | 12/31/15 | Atombryan | 1 |
Easy DIY Protein (For more precision then the other one) | CLOSED | 12/11/15 | 12/31/15 | Atombryan | 2 |
HIV solvers | CLOSED | 12/31/15 | 04/01/16 | Sammie123 | 1 |
Freestyle Design | CLOSED | 12/16/15 | 12/25/15 | 01010011111 | 1 |
Freestyle Design 20 | CLOSED | 12/16/15 | 12/31/15 | 01010011111 | 1 |
Contest Template Test | CLOSED | 12/21/15 | 12/31/15 | 01010011111 | 1 |
Merry post-christmas | CLOSED | 12/25/15 | 12/28/15 | -x- | 1 |
161 | CLOSED | 12/26/15 | 12/31/15 | shunsuketagami | 1 |
di trimmer ligand version | CLOSED | 12/31/15 | 05/01/16 | ChrisScientist | 1 |
ligamaze | CLOSED | 12/31/15 | 03/31/16 | ChrisScientist | 1 |
Freestyle Design 200 | CLOSED | 01/11/16 | 01/01/17 | 01010011111 | 1 |
Freestyle Design 500 | CLOSED | 01/11/16 | 01/31/16 | 01010011111 | 1 |
Freestyle Symmetric Design: 80 Trimer | CLOSED | 01/15/16 | 01/31/16 | 01010011111 | 1 |
HIV protease - BIOL225 | CLOSED | 01/28/16 | 02/04/16 | Siderhurst | 11 |
Ice-structuring protein | CLOSED | 02/01/16 | 02/29/16 | Tajuton_potilas2 | 1 |
CLASS CONTEST | CLOSED | 02/29/16 | 03/31/16 | Herojohn17 | 0 |
peter and kim | CLOSED | 02/03/16 | 04/02/16 | petetrig | 1 |
peter and kim | CLOSED | 02/03/16 | 06/11/16 | petetrig | 1 |
Freestyle Design 20 | CLOSED | 02/08/16 | 02/29/16 | 01010011111 | 1 |
Biophysical chemistry workshop - University of Edinburgh | CLOSED | 02/08/16 | 04/25/16 | jmichel80 | 12 |
Group V Biophysics BITSG | CLOSED | 02/09/16 | 05/16/16 | SandyVii | 1 |
AMP1 | CLOSED | 02/15/16 | 02/17/16 | grubbybio | 1 |
Miami University | CLOSED | 02/18/16 | 02/21/16 | dirk41 | 1 |
Teste | CLOSED | 02/25/16 | 02/12/19 | NotEvenTryingM8 | 1 |
Pseudomonas aeruginosa PA4063 | CLOSED | 02/28/16 | 03/31/16 | mutinus | 1 |
Contest name | CLOSED | 03/03/16 | 03/04/16 | Kristian Rodman | 0 |
HIV Protease | CLOSED | 03/16/16 | 06/01/16 | CureForDiabetes | 1 |
WSC Bioc Spring 2016 | CLOSED | 03/25/16 | 04/10/16 | jcnichols | 18 |
sgner | CLOSED | 04/07/16 | 04/08/16 | sgner | 0 |
sgner1 | CLOSED | 04/07/16 | 04/08/16 | sgner | 1 |
sgnerTEST | CLOSED | 04/07/16 | 04/08/16 | sgner | 1 |
Contest | CLOSED | 04/14/16 | 04/15/16 | mxwly | 3 |
Fold it! | CLOSED | 04/19/16 | 06/19/16 | krzysztofbulenger | 0 |
Fomento CS | CLOSED | 04/19/16 | 04/29/16 | fomento00 | 1 |
Freestyle RRM | CLOSED | 04/22/16 | 11/29/16 | obiwan | 0 |
Freestyle RRM | CLOSED | 04/22/16 | 11/29/16 | obiwan | 0 |
Baltyho prirozeni zda se byt smesne male | CLOSED | 04/28/16 | 04/29/16 | MMBP2016-HonJi | 1 |
ERN-Transmembran | CLOSED | 04/29/16 | 04/30/16 | zduzgun | 1 |
DENE | CLOSED | 04/30/16 | 05/01/16 | zduzgun | 1 |
Test Contest - ML | CLOSED | 05/01/16 | 08/31/16 | MrMark2014 | 3 |
Viral accessory protein | CLOSED | 05/03/16 | 05/22/16 | Zephrin | 1 |
Two symmetric chains, 40 segments each; all can be designed. | CLOSED | 05/03/16 | 05/05/16 | zduzgun | 1 |
Contest Template Test | CLOSED | 05/04/16 | 05/06/16 | zduzgun | 1 |
An 500 segment extended chain that can all be designed. | CLOSED | 05/04/16 | 05/06/16 | zduzgun | 1 |
This freestyle puzzle has mutable residues and allows you to add or delete residues | CLOSED | 05/04/16 | 05/06/16 | zduzgun | 1 |
Freestyle Design 20 | CLOSED | 05/09/16 | 05/29/16 | 01010011111 | 1 |
Zia | CLOSED | 05/17/16 | 08/27/16 | Ziauddin Ahmer | 0 |
Lac repressor | CLOSED | 05/17/16 | 05/24/16 | dunawayjacob | 1 |
Protein Stability | CLOSED | 05/31/16 | 12/31/16 | Alisa Southerncross | 0 |
GTPase | CLOSED | 06/02/16 | 09/15/16 | yjguo_10 | 0 |
ARSB | CLOSED | 06/10/16 | 07/29/16 | szeitler18 | 0 |
test | CLOSED | 07/12/16 | 07/13/16 | guolab | 1 |
1 | CLOSED | 07/22/16 | 07/23/16 | liyixiao | 1 |
20 segment extended chain that can all be designed. | CLOSED | 07/27/16 | 08/12/16 | 01010011111 | 1 |
BendBobsPlayItYourWay | CLOSED | 07/28/16 | 07/28/19 | bendbob | 1 |
1 | CLOSED | 08/04/16 | 08/06/16 | rossco0407 | 1 |
Practice_folding_from_scratch | CLOSED | 08/22/16 | 12/01/16 | Miguel.alj390 | 1 |
TIM Barrel Design | CLOSED | 08/29/16 | 09/02/16 | Rsteele7 | 1 |
TIM Barrel Design | CLOSED | 08/29/16 | 09/02/16 | Rsteele7 | 1 |
TIM Barrel | CLOSED | 09/01/16 | 09/09/16 | Rsteele7 | 1 |
TIM 200 | CLOSED | 09/01/16 | 09/09/16 | Rsteele7 | 1 |
Help Cure HIV | CLOSED | 09/05/16 | 09/30/16 | Toyo | 1 |
GTPase Ras | CLOSED | 09/16/16 | 12/08/16 | hgenzman21 | 1 |
DuquesnePJAS1 | CLOSED | 09/23/16 | 09/25/16 | EmilyB | 6 |
DuquesnePJAS2 | CLOSED | 09/23/16 | 09/25/16 | EmilyB | 6 |
DuquesnePJAS3 | CLOSED | 09/23/16 | 09/25/16 | EmilyB | 6 |
Biochem-AD16 | CLOSED | 09/23/16 | 10/07/16 | Yocan | 1 |
LOL FU | CLOSED | 09/30/16 | 10/30/16 | BroC4 | 1 |
CH 410 Puzzle 1 | CLOSED | 11/30/16 | 12/13/16 | ProfCollins | 15 |
test 1 | CLOSED | 09/27/16 | 09/29/16 | ionickiwi | 1 |
Variable Length Protein Structure | CLOSED | 09/29/16 | 12/31/16 | Atombryan | 1 |
Sandbox | CLOSED | 09/30/16 | 10/02/16 | CollBio | 1 |
my contest | CLOSED | 10/01/16 | 10/30/16 | Carlos Santamaria | 1 |
Test | CLOSED | 10/14/16 | 10/16/16 | immac636 | 1 |
raid | CLOSED | 10/19/16 | 10/20/16 | TheEnderCavalier | 1 |
biyokimya_2016_1 | CLOSED | 10/19/16 | 10/23/16 | biyokimya_2016_ismailhoca | 0 |
biyokimya_2016_1.hafta | CLOSED | 10/19/16 | 10/23/16 | biyokimya_2016_ismailhoca | 1 |
deneme_1 | CLOSED | 10/19/16 | 10/20/16 | ismailhakkiakgun | 1 |
ismailhakkiakgun | CLOSED | 10/19/16 | 10/24/16 | ismailhakkiakgun | 1 |
raid 2 | CLOSED | 10/20/16 | 10/21/16 | TheEnderCavalier | 1 |
WSU Bioc Fall 16 | CLOSED | 10/20/16 | 11/03/16 | jcnichols | 2 |
Raid 3 | CLOSED | 10/21/16 | 10/22/16 | TheEnderCavalier | 0 |
WSU Fall 16 Biochemistry | CLOSED | 11/02/16 | 11/20/16 | jcnichols | 17 |
My Contest | CLOSED | 11/04/16 | 11/05/16 | Benbennett2000 | 3 |
Breakfast of Champions | CLOSED | 11/04/16 | 11/10/16 | bowman1334 | 1 |
Biochem 124 | CLOSED | 11/12/16 | 11/13/16 | John Carlo dela Cruz | 0 |
Eric's Test | CLOSED | 11/15/16 | 11/17/16 | ebrenner14 | 1 |
test-tintin-hiv | CLOSED | 11/22/16 | 11/23/16 | tintin1343 | 1 |
Practice Space--FREESTYLE: VARIABLE LENGTH | CLOSED | 11/24/16 | 11/21/18 | Puttering | 1 |
Practice Space--SEAL MYOGLOBIN | CLOSED | 11/24/16 | 11/21/18 | Puttering | 1 |
BC 124 | CLOSED | 11/30/16 | 12/06/16 | roandavila | 7 |
Test | CLOSED | 12/03/16 | 12/04/16 | Justine18 | 1 |
Adventure | CLOSED | 12/03/16 | 12/04/16 | Justine18 | 1 |
BCH 441 Fold my protein contest | CLOSED | 12/04/16 | 12/05/16 | ryanolson41 | 1 |
SK SK II | CLOSED | 12/04/16 | 12/31/19 | ScratchKid | 1 |
abeta- binder | CLOSED | 12/06/16 | 12/08/16 | tintin1343 | 1 |
SK III! | CLOSED | 12/07/16 | 12/31/19 | ScratchKid | 1 |
BIOL1300/2300-2016 contest | CLOSED | 12/09/16 | 12/31/16 | nfawzi | 1 |
Fold like the wind (blow me away) | CLOSED | 12/11/16 | 12/31/16 | kath2656 | 0 |
BIOL1300/2300 Frizzled | CLOSED | 12/12/16 | 12/31/16 | biol1300_nick | 21 |
BIOL1300/2300 Abeta binder | CLOSED | 12/12/16 | 12/31/16 | biol1300_nick | 20 |
SK IV | CLOSED | 12/29/16 | 12/31/15 | ScratchKid | 0 |
SK V | CLOSED | 12/29/16 | 12/31/19 | ScratchKid | 1 |
SK VI | CLOSED | 12/29/16 | 12/31/19 | ScratchKid | 1 |
SK VII | CLOSED | 12/29/16 | 12/31/92 | ScratchKid | 1 |
1v Foldit-1 F2017 | CLOSED | 01/05/17 | 01/18/17 | kipasceu | 0 |
1v Foldit 1 | CLOSED | 01/02/17 | 01/18/17 | kipasceu | 1 |
TrollFace games | CLOSED | 01/12/17 | 01/14/17 | TrollFace2002 | 1 |
MGC - 2017 | CLOSED | 01/18/17 | 01/24/17 | Kimbostu | 7 |
HIV PROTEASE | CLOSED | 01/18/17 | 02/01/17 | gu14001 | 0 |
Collins CH 410 | CLOSED | 02/01/17 | 05/10/17 | ProfCollins | 11 |
Biochem 463 lab 1 | CLOSED | 01/24/17 | 01/25/17 | BWeber | 1 |
i | CLOSED | 01/27/17 | 01/30/17 | zduzgun | 1 |
SK VII | CLOSED | 02/02/17 | 12/31/20 | ScratchKid | 1 |
test contest | CLOSED | 02/07/17 | 02/28/17 | brbfold | 1 |
CHE 8592 Greek Key Challenge | CLOSED | 02/09/17 | 02/16/17 | jakelmer | 15 |
Twelver | CLOSED | 02/12/17 | 12/31/20 | ScratchKid | 1 |
erj | CLOSED | 02/12/17 | 12/31/20 | ScratchKid | 1 |
iRFP | CLOSED | 02/13/17 | 02/13/20 | amao1 | 1 |
iRFP 2 | CLOSED | 02/13/17 | 02/13/20 | amao1 | 1 |
AEL | CLOSED | 02/14/17 | 02/15/17 | JaeYeong | 0 |
Test Contest for Lorna | CLOSED | 02/17/17 | 02/19/17 | dsilva.l | 1 |
axin solve | CLOSED | 02/14/17 | 02/16/17 | NiPatFeb2017 | 1 |
Dave's challenge of despair | CLOSED | 02/23/17 | 02/24/17 | bsdn | 0 |
MC&SDRocks | CLOSED | 02/27/17 | 02/24/18 | SunSalutation | 2 |
Miniprotein1L2Y | CLOSED | 04/23/17 | 05/23/17 | Bruno Kestemont | 4 |
#awesome | CLOSED | 03/02/17 | 03/03/17 | roachfamilymaine | 1 |
Test 3V1A | CLOSED | 03/02/17 | 05/02/17 | Scopper | 1 |
Freestyle Design 40 Contest #1 | CLOSED | 03/06/17 | 03/13/17 | FutureScientist1212 | 1 |
Freestyle Design 80 Contest #2 | CLOSED | 03/13/17 | 03/20/17 | FutureScientist1212 | 1 |
test | CLOSED | 03/07/17 | 03/08/17 | lhatsk | 1 |
Test | CLOSED | 03/12/17 | 03/14/17 | 28SciOne | 1 |
Test2 | CLOSED | 03/12/17 | 03/19/17 | 28SciOne | 1 |
Team 5 Project | CLOSED | 03/12/17 | 03/31/17 | 28SciOne | 5 |
SEAL MYOGLOBIN | CLOSED | 03/13/17 | 05/11/17 | srinaldi1656 | 1 |
Team 11 Test | CLOSED | 03/18/17 | 03/19/17 | 50SciOne | 2 |
Science One Team 10 Project | CLOSED | 03/20/17 | 04/01/17 | 06SciOne | 4 |
team 6!! | CLOSED | 03/21/17 | 03/25/17 | 20SciOne | 5 |
University of Edinburgh Biophysical chemistry workshop 2017 | CLOSED | 03/21/17 | 07/01/17 | jmichel80 | 9 |
Super Easy | CLOSED | 04/01/17 | 05/03/17 | AndriiMiller | 1 |
Chem 365? | CLOSED | 04/02/17 | 04/30/17 | koehlr60chem365 | 1 |
WSU Bioc 1 S18 | CLOSED | 04/05/17 | 04/23/17 | jcnichols | 16 |
Forf | CLOSED | 04/10/17 | 04/11/17 | Leser | 1 |
200-residue design puzzle test | CLOSED | 04/12/17 | 04/18/17 | LociOiling | 1 |
Back to the Future | CLOSED | 04/18/17 | 05/16/17 | chingsong | 43 |
3V1A | CLOSED | 04/23/17 | 05/23/17 | Bruno Kestemont | 9 |
Structural-Bioinformatics | CLOSED | 04/24/17 | 05/08/17 | AnnaSophalK | 9 |
HIV Protease Folding | CLOSED | 05/10/17 | 05/13/17 | Komsomolez | 6 |
Check | CLOSED | 05/12/17 | 05/14/17 | ProfCollins | 1 |
GeneEngineering | CLOSED | 05/16/17 | 06/15/17 | chingsong | 68 |
testComm | CLOSED | 07/22/17 | 08/20/17 | dsilva.l | 2 |
freestyle synthetic protein designs | CLOSED | 06/12/17 | 07/12/17 | jigs | 1 |
QQ | CLOSED | 06/21/17 | 07/20/17 | 41607431 | 1 |
yuqianhengyuan | CLOSED | 06/26/17 | 06/27/17 | yuqianhengyuan | 0 |
freestyle 20 | CLOSED | 07/25/17 | 08/22/17 | PatricioBato | 1 |
Freestyle 40 | CLOSED | 07/25/17 | 08/24/17 | PatricioBato | 1 |
contest | CLOSED | 08/01/17 | 08/31/17 | folditguy123098 | 3 |
Chains! | CLOSED | 08/03/17 | 09/02/17 | Mao Mao | 1 |
Custom 500 | CLOSED | 08/07/17 | 09/06/17 | khendarg | 1 |
Testing | CLOSED | 08/23/17 | 09/21/17 | Dr.Chi | 0 |
Cell Bio | CLOSED | 08/22/17 | 08/24/17 | Dr.Chi | 1 |
testA1 | CLOSED | 08/24/17 | 08/25/17 | ksz | 1 |
the fun alot | CLOSED | 08/28/17 | 08/29/17 | randcvn | 0 |
Freedom | CLOSED | 09/13/17 | 09/14/17 | LilinC33 | 1 |
HIV Trouble | CLOSED | 09/18/17 | 09/30/17 | LOGOLOZ | 1 |
Ronny-test | CLOSED | 09/22/17 | 09/30/17 | ronnygeo | 1 |
Frestyle contest | CLOSED | 10/04/17 | 10/08/17 | maximiliancarey | 1 |
Test Custom Contest - dev03 | CLOSED | 10/09/17 | 10/12/17 | ronnygeo | 1 |
Extracellular peptide | CLOSED | 10/18/17 | 10/25/17 | danielofs | 1 |
1V1 ME UNLESS UR SCARED | CLOSED | 10/19/17 | 10/21/17 | I dom1nate | 0 |
DONG1 protein | CLOSED | 10/20/17 | 11/11/17 | cxlpku | 1 |
test 1 | CLOSED | 10/20/17 | 10/31/17 | cxlpku | 1 |
Bio-Tech 2k17 | CLOSED | 10/20/17 | 10/21/17 | JosephNi | 9 |
bend it | CLOSED | 10/25/17 | 11/05/17 | Marlfox3 | 0 |
WSC Bioc 1 F17 EC | CLOSED | 11/03/17 | 11/18/17 | jcnichols | 15 |
me and freinds | CLOSED | 11/05/17 | 11/07/17 | Nusayr | 1 |
test123 | CLOSED | 11/07/17 | 11/08/17 | horowsah | 1 |
Mr Faure 1v1 me lmao 100XDDDDDDDDDDD | CLOSED | 11/14/17 | 11/15/17 | B0B0 | 5 |
Block 11 | CLOSED | 11/16/17 | 11/26/17 | drigginar | 0 |
Biochem 1 Extra Credit | CLOSED | 11/17/17 | 12/15/17 | ProfCollins | 14 |
USTB2017 | CLOSED | 11/29/17 | 12/29/17 | chingsong | 29 |
WTF! BOOM | CLOSED | 12/01/17 | 12/03/17 | DomasterPM | 1 |
Cool | CLOSED | 12/02/17 | 01/01/18 | BaiYang | 0 |
Cool | CLOSED | 12/02/17 | 01/01/18 | BaiYang | 1 |
New City Science | CLOSED | 12/09/17 | 12/10/17 | caitlin@newcitycharterschool.org | 0 |
ycgE | CLOSED | 12/08/17 | 12/11/17 | cjkunze1 | 0 |
NCCS weeaboos | CLOSED | 12/07/17 | 12/08/17 | sushiboi | 0 |
NCCS weeaboos | CLOSED | 12/07/17 | 12/08/17 | sushiboi | 0 |
Werncs | CLOSED | 12/07/17 | 12/08/17 | caitlin@newcitycharterschool.org | 11 |
New City Charter School | CLOSED | 12/09/17 | 12/10/17 | caitlin@newcitycharterschool.org | 43 |
Global | CLOSED | 12/16/17 | 12/17/17 | ckluo | 2 |
A Test Custom Contest | CLOSED | 12/29/17 | 12/31/17 | Seth Cooper | 0 |
A Test Custom Contest - fold.it | CLOSED | 12/29/17 | 12/31/17 | Seth Cooper | 1 |
A Test Custom Contest 2 - fold.it | CLOSED | 12/29/17 | 12/31/17 | Seth Cooper | 0 |
test9 | CLOSED | 12/29/17 | 12/30/17 | horowsah | 1 |
name name | CLOSED | 01/01/18 | 01/05/18 | 01010011111 | 1 |
name 2 | CLOSED | 01/01/18 | 01/20/18 | 01010011111 | 1 |
name 500 | CLOSED | 01/01/18 | 01/20/18 | 01010011111 | 1 |
name 150 | CLOSED | 01/02/18 | 01/19/18 | 01010011111 | 1 |
Noc Biologów test | CLOSED | 01/09/18 | 01/12/18 | decu | 1 |
test17 | CLOSED | 01/09/18 | 01/10/18 | horowsah | 1 |
asdf | CLOSED | 01/09/18 | 01/31/18 | Seth Cooper | 0 |
test18 | CLOSED | 01/09/18 | 01/10/18 | horowsah | 1 |
test19 | CLOSED | 01/09/18 | 01/10/18 | horowsah | 1 |
test20 | CLOSED | 01/09/18 | 01/10/18 | horowsah | 1 |
test21 | CLOSED | 01/09/18 | 01/10/18 | horowsah | 1 |
test22 | CLOSED | 01/09/18 | 01/10/18 | horowsah | 1 |
test23 | CLOSED | 01/09/18 | 01/10/18 | horowsah | 1 |
DUSP6 | CLOSED | 01/13/18 | 02/11/18 | Bruno Kestemont | 1 |
DUSP6 | CLOSED | 01/13/18 | 02/11/18 | Bruno Kestemont | 1 |
DU Phosphorous 2018 | CLOSED | 01/11/18 | 01/26/18 | horowsah | 8 |
DU TAR 2018 | CLOSED | 01/11/18 | 02/02/18 | horowsah | 10 |
DU Chaperone 2018 | CLOSED | 01/11/18 | 02/09/18 | horowsah | 10 |
test | CLOSED | 01/12/18 | 01/24/18 | Uttkarsh | 1 |
Biophysical chemistry workshop University of Edinburgh | CLOSED | 01/12/18 | 02/11/18 | jmichel80 | 14 |
Noc Biologow 2018 WB UW | CLOSED | 01/12/18 | 01/13/18 | decu | 13 |
test contest 04 | CLOSED | 01/13/18 | 01/31/18 | josh04 | 1 |
test for josh03 | CLOSED | 01/15/18 | 01/22/18 | josh03 | 1 |
testbibs | CLOSED | 01/16/18 | 01/17/18 | Addreoran | 1 |
DU Enzyme 2018 | CLOSED | 01/17/18 | 02/16/18 | horowsah | 10 |
PM_1 | CLOSED | 01/17/18 | 01/27/18 | PM_KSienkiewicz | 0 |
PM_2 | CLOSED | 01/18/18 | 01/27/18 | PM_KSienkiewicz | 5 |
Ali G | CLOSED | 01/22/18 | 01/29/18 | JonnyT | 0 |
Human Neuritin | CLOSED | 01/25/18 | 02/24/18 | Topo24 | 1 |
pranav | CLOSED | 01/28/18 | 01/29/18 | pranavchels | 0 |
test contest | CLOSED | 02/05/18 | 02/08/18 | samicheen | 1 |
Test custom contest | CLOSED | 02/06/18 | 02/11/18 | samicheen | 1 |
CH 410 EC | CLOSED | 02/09/18 | 03/09/18 | ProfCollins | 10 |
DU AB 2018 | CLOSED | 02/12/18 | 03/12/18 | horowsah | 10 |
For Fun | CLOSED | 02/12/18 | 03/12/18 | srinaldi1656 | 1 |
acka | CLOSED | 02/15/18 | 03/17/18 | rolfpf | 1 |
Lol tuturial | CLOSED | 02/20/18 | 02/21/18 | danielvan1994 | 3 |
phosphate | CLOSED | 03/01/18 | 03/29/18 | horowsah | 2 |
HIV | CLOSED | 03/01/18 | 03/29/18 | horowsah | 1 |
groel | CLOSED | 03/01/18 | 03/29/18 | horowsah | 1 |
enzyme | CLOSED | 03/01/18 | 03/29/18 | horowsah | 1 |
ADAM | CLOSED | 02/28/18 | 03/27/18 | psloliveira | 1 |
citodomain | CLOSED | 02/28/18 | 03/27/18 | psloliveira | 1 |
GeneDesign | CLOSED | 03/08/18 | 04/07/18 | chingsong | 55 |
pranavtest | CLOSED | 03/15/18 | 03/16/18 | pranavchels | 0 |
PM_PEGAZ | CLOSED | 03/20/18 | 03/31/18 | PM_KSienkiewicz | 11 |
2002949_0000 test | CLOSED | 03/22/18 | 03/31/18 | Seth Cooper | 0 |
2002949_0000_from_scooper | CLOSED | 03/26/18 | 03/31/18 | bkoep | 1 |
2003169_S953 | CLOSED | 03/25/18 | 03/31/18 | bkoep | 1 |
2002949_0000 | CLOSED | 03/25/18 | 04/22/18 | bkoep | 3 |
WSC Bioc1 S18 EC | CLOSED | 04/02/18 | 04/22/18 | jcnichols | 13 |
test17 | CLOSED | 04/03/18 | 04/04/18 | horowsah | 0 |
test18 | CLOSED | 04/03/18 | 04/04/18 | horowsah | 0 |
test17 | CLOSED | 04/05/18 | 04/06/18 | horowsah | 1 |
test18 | CLOSED | 04/05/18 | 04/06/18 | horowsah | 1 |
test19 | CLOSED | 04/05/18 | 04/06/18 | horowsah | 1 |
cavs 49-30 | CLOSED | 04/06/18 | 04/13/18 | 2013345 | 1 |
test | CLOSED | 04/07/18 | 04/08/18 | samicheen | 0 |
CCBs-Next-TopModel | CLOSED | 04/09/18 | 04/30/18 | AnnaSophalK | 1 |
Turma 302 COLTEC | CLOSED | 04/09/18 | 04/20/18 | camiladlopes | 1 |
Desafio proteĆnas do HIV | CLOSED | 04/09/18 | 04/20/18 | camiladlopes | 1 |
biotek | CLOSED | 04/10/18 | 04/13/18 | Aminstrater | 1 |
4bws test | CLOSED | 04/11/18 | 04/13/18 | bkoep | 1 |
test20 | CLOSED | 04/11/18 | 04/12/18 | horowsah | 0 |
abc | CLOSED | 04/14/18 | 04/15/18 | samicheen | 0 |
test30 | CLOSED | 04/16/18 | 04/17/18 | horowsah | 1 |
test description | CLOSED | 04/16/18 | 04/17/18 | samicheen | 0 |
test31 | CLOSED | 04/18/18 | 04/19/18 | horowsah | 0 |
test title | CLOSED | 04/20/18 | 04/27/18 | Seth Cooper | 0 |
test32 | CLOSED | 04/23/18 | 04/24/18 | horowsah | 1 |
test32 | CLOSED | 04/26/18 | 04/27/18 | horowsah | 1 |
test33 | CLOSED | 05/01/18 | 05/02/18 | horowsah | 1 |
Challanger40s | CLOSED | 05/02/18 | 05/27/18 | MatheRaph | 1 |
customposter contest | CLOSED | 05/03/18 | 05/31/18 | customposter | 1 |
test34 | CLOSED | 05/03/18 | 05/05/18 | horowsah | 1 |
test35 | CLOSED | 05/03/18 | 05/04/18 | horowsah | 0 |
contest_node_form contest_node_form | CLOSED | 05/10/18 | 05/13/18 | customposter | 0 |
2003333_0006 zip | CLOSED | 05/03/18 | 05/17/18 | bkoep | 1 |
template contest test 2 | CLOSED | 05/07/18 | 05/14/18 | Seth Cooper | 0 |
custom contest test 2 | CLOSED | 05/07/18 | 05/14/18 | Seth Cooper | 0 |
template contest test 3 | CLOSED | 05/07/18 | 05/14/18 | Seth Cooper | 0 |
custom contest test 3 | CLOSED | 05/07/18 | 05/14/18 | Seth Cooper | 0 |
test template | CLOSED | 05/04/18 | 05/05/18 | samicheen | 0 |
2003333_0006 zip2 | CLOSED | 05/06/18 | 05/27/18 | bkoep | 1 |
2003333_0006 | CLOSED | 05/06/18 | 05/27/18 | bkoep | 2 |
test_edit2 | CLOSED | 05/06/18 | 05/13/18 | bkoep | 1 |
test35 | CLOSED | 05/06/18 | 05/07/18 | horowsah | 1 |
test36444 | CLOSED | 05/06/18 | 05/07/18 | horowsah | 1 |
Custom Contest 1 | CLOSED | 05/08/18 | 05/10/18 | customposter | 0 |
Custom Contest | CLOSED | 05/08/18 | 05/10/18 | customposter | 2 |
Freestyle Design: Variable Length | CLOSED | 05/10/18 | 05/11/18 | ac281201 | 1 |
500 proteine | CLOSED | 05/14/18 | 05/18/18 | 01010011111 | 1 |
Heather and Nate | CLOSED | 05/16/18 | 05/17/18 | heatherlapier | 1 |
test | CLOSED | 05/16/18 | 05/17/18 | customposter | 1 |
test1 | CLOSED | 05/16/18 | 05/17/18 | customposter | 1 |
test2 | CLOSED | 05/16/18 | 05/17/18 | customposter | 1 |
Heather and Nate Round 2 | CLOSED | 05/16/18 | 05/17/18 | heatherlapier | 2 |
Heather and Nate Round 3 LOL | CLOSED | 05/16/18 | 05/17/18 | heatherlapier | 2 |
another test | CLOSED | 05/17/18 | 05/19/18 | josh03 | 0 |
TEST UofGuelph iGEM 2018 oxIT | CLOSED | 05/21/18 | 06/20/18 | RestrictionEndoNykolease | 3 |
Test FDVL | CLOSED | 05/21/18 | 06/20/18 | Madde | 1 |
Loci's test contest test | CLOSED | 05/21/18 | 05/22/18 | LociOiling | 1 |
trial | CLOSED | 05/22/18 | 05/31/18 | customposter | 2 |
test2 | CLOSED | 05/22/18 | 05/31/18 | customposter | 1 |
test3 | CLOSED | 05/22/18 | 05/31/18 | customposter | 1 |
test pdb | CLOSED | 05/24/18 | 05/25/18 | samicheen | 1 |
5GOZ Test Contest | CLOSED | 05/24/18 | 06/21/18 | Matthew Hantsbarger | 4 |
2003333_0006_test | CLOSED | 05/24/18 | 05/31/18 | bkoep | 1 |
test puzzle | CLOSED | 05/24/18 | 05/25/18 | samicheen | 1 |
test puzzle new | CLOSED | 05/24/18 | 05/25/18 | samicheen | 1 |
test puzzle uncheck | CLOSED | 05/24/18 | 05/25/18 | samicheen | 0 |
5GOZ test contest 6 | CLOSED | 05/29/18 | 06/26/18 | Matthew Hantsbarger | 5 |
test | CLOSED | 05/29/18 | 05/30/18 | joshmiller | 0 |
test pdb | CLOSED | 05/30/18 | 05/31/18 | samicheen | 1 |
testt | CLOSED | 06/06/18 | 06/07/18 | horowsah | 1 |
5GOZ test contest 6.3 | CLOSED | 06/06/18 | 07/04/18 | Matthew Hantsbarger | 1 |
Lindert OSC Day | CLOSED | 06/20/18 | 06/22/18 | bowman1334 | 2 |
5GOZ test contest 6.8 | CLOSED | 06/19/18 | 07/17/18 | Matthew Hantsbarger | 1 |
test | CLOSED | 06/22/18 | 07/16/18 | Bruno Kestemont | 0 |
Abeta Binder Test2 | CLOSED | 06/25/18 | 07/02/18 | Matthew Hantsbarger | 1 |
What can you do??? | CLOSED | 06/25/18 | 06/26/18 | Carrie_W | 1 |
The coolest in 5212 | CLOSED | 06/29/18 | 07/09/18 | CarlQAQ | 1 |
Loci's variable length design contest | CLOSED | 07/03/18 | 07/31/18 | LociOiling | 3 |
test | CLOSED | 07/07/18 | 07/31/18 | tyler0911 | 1 |
nanobody | CLOSED | 07/09/18 | 08/07/18 | Bogdan Barnych | 1 |
GeneDesign2nd | CLOSED | 07/12/18 | 07/29/18 | chingsong | 1 |
test | CLOSED | 07/13/18 | 07/14/18 | qk9031 | 1 |
5GOZ 9.0 test | CLOSED | 07/19/18 | 07/26/18 | Matthew Hantsbarger | 2 |
helphaver | CLOSED | 07/21/18 | 07/24/18 | korinnac | 0 |
FREESTYLE | CLOSED | 07/21/18 | 07/22/18 | aneeta | 0 |
Moe | CLOSED | 07/22/18 | 08/20/18 | ivalnic | 1 |
Abeta Binder Piecewise Design | CLOSED | 08/16/18 | 08/31/18 | Uttkarsh | 1 |
SEAL MYOGLOBIN | CLOSED | 08/16/18 | 08/31/18 | Uttkarsh | 1 |
Freestyle Design: Variable Length | CLOSED | 08/16/18 | 08/31/18 | Uttkarsh | 1 |
test 1 | CLOSED | 08/19/18 | 09/16/18 | qk9031 | 1 |
test -2 | CLOSED | 08/19/18 | 08/31/18 | qk9031 | 1 |
test_fetch_contest | CLOSED | 08/29/18 | 08/31/18 | bkoep | 1 |
test_fetch_cleared_cache | CLOSED | 08/30/18 | 09/06/18 | bkoep | 1 |
test_contest_resiefilter | CLOSED | 08/30/18 | 09/06/18 | bkoep | 1 |
test_contest_rmsdfilter | CLOSED | 08/30/18 | 09/06/18 | bkoep | 1 |
test | CLOSED | 09/01/18 | 09/02/18 | peterwashington | 1 |
Martin's foldfest | CLOSED | 09/05/18 | 09/06/18 | sanmartin | 2 |
this is a test | CLOSED | 09/13/18 | 09/16/18 | merlin2v | 1 |
Denovo design 1 | CLOSED | 09/18/18 | 10/01/18 | zhart | 1 |
designprotein | CLOSED | 09/20/18 | 10/20/18 | pwseo | 1 |
BC 124 - UPM - FoldIt Challenge | CLOSED | 09/24/18 | 10/08/18 | Quantumerical | 16 |
polyVC1 | CLOSED | 09/25/18 | 09/25/19 | bkoep | 4 |
polyVC2 | CLOSED | 09/26/18 | 09/26/19 | bkoep | 2 |
polyVF1 | CLOSED | 09/26/18 | 09/26/19 | bkoep | 2 |
polyVF2 | CLOSED | 09/26/18 | 09/26/19 | bkoep | 2 |
polyVZ1 | CLOSED | 09/26/18 | 09/26/19 | bkoep | 2 |
polyVZ2 | CLOSED | 09/26/18 | 09/26/19 | bkoep | 2 |
test40 | CLOSED | 09/26/18 | 09/27/18 | horowsah | 2 |
test-custom16 | CLOSED | 10/01/18 | 10/07/18 | Seth Cooper | 0 |
test-custom17 | CLOSED | 10/01/18 | 10/07/18 | Seth Cooper | 0 |
test-custom19 | CLOSED | 10/01/18 | 10/07/18 | Seth Cooper | 1 |
test-custom20 | CLOSED | 10/01/18 | 10/07/18 | Seth Cooper | 1 |
test-custom21 | CLOSED | 10/01/18 | 10/07/18 | Seth Cooper | 1 |
test-custom21 | CLOSED | 10/01/18 | 10/07/18 | Seth Cooper | 1 |
test46 | CLOSED | 10/03/18 | 10/06/18 | horowsah | 1 |
a-Synuclein Inhibitor Test | CLOSED | 10/03/18 | 10/31/18 | SleepyPanda123 | 1 |
Inhibitor design vs a-syn | CLOSED | 10/03/18 | 10/31/18 | SleepyPanda123 | 1 |
Beginner Puzzle | CLOSED | 10/05/18 | 10/07/18 | yayiding | 1 |
Beginner Puzzle Pro | CLOSED | 10/05/18 | 10/20/18 | yayiding | 1 |
test46 | CLOSED | 10/08/18 | 10/09/18 | horowsah | 2 |
test47 | CLOSED | 10/08/18 | 10/09/18 | horowsah | 1 |
test48 | CLOSED | 10/08/18 | 10/09/18 | horowsah | 1 |
test49 | CLOSED | 10/08/18 | 10/09/18 | horowsah | 1 |
test50 | CLOSED | 10/08/18 | 10/09/18 | horowsah | 1 |
test51 | CLOSED | 10/08/18 | 10/09/18 | customposter | 1 |
FA18_CH410_EC | CLOSED | 01/01/30 | 11/08/18 | ProfCollins | 14 |
test-custom1 | CLOSED | 10/15/18 | 10/21/18 | Seth Cooper | 0 |
test-custom2 | CLOSED | 10/15/18 | 10/22/18 | Seth Cooper | 1 |
test50 | CLOSED | 10/14/18 | 10/15/18 | horowsah | 1 |
Spider Silk | CLOSED | 10/19/18 | 10/31/18 | icaru-5 | 1 |
Loci's test contest test | CLOSED | 10/28/18 | 10/30/18 | LociOiling | 0 |
Practice for HIV Protease | CLOSED | 10/28/18 | 11/20/18 | DaedalusLabs | 1 |
WSU Fall 2018 EC Contest | CLOSED | 10/31/18 | 11/12/18 | jcnichols | 13 |
Ellington Biochemistry Class | CLOSED | 11/08/18 | 11/13/18 | emkbowman | 6 |
WSU Fall 18 EC temp | CLOSED | 11/07/18 | 11/18/18 | jcnichols | 1 |
Loci's seal myoglobin test | CLOSED | 11/12/18 | 11/19/18 | LociOiling | 2 |
Loci's T0743 contest | CLOSED | 11/12/18 | 11/19/18 | LociOiling | 1 |
Are you kidding me? | CLOSED | 11/13/18 | 11/14/18 | jcnichols | 1 |
IBG2 | CLOSED | 11/23/18 | 11/24/18 | ujehn | 1 |
Gaming For Research Event | CLOSED | 11/27/18 | 11/28/18 | walid.alitani | 28 |
AlbA, | CLOSED | 12/03/18 | 01/02/19 | icaru-5 | 1 |
CASP13 | CLOSED | 12/05/18 | 12/31/18 | callmekoo | 1 |
freestyle | CLOSED | 12/06/18 | 12/31/18 | xm109sr | 1 |
biol1300_2018 | CLOSED | 01/01/30 | 12/31/18 | biol1300_nick | 19 |
biol1300_2018_2 | CLOSED | 12/06/18 | 12/31/18 | biol1300_nick | 19 |
biol1300_2018_3 | CLOSED | 12/06/18 | 12/31/18 | biol1300_nick | 16 |
zz zz | CLOSED | 12/11/18 | 12/19/18 | CaoKBiol1300 | 1 |
SMT 1 | CLOSED | 12/13/18 | 12/21/18 | levand.csa | 1 |
testb | CLOSED | 12/17/18 | 12/18/18 | horowsah | 1 |
guanzhuang | CLOSED | 12/19/18 | 01/18/19 | chingsong | 32 |
2002290_S122 | CLOSED | 01/09/19 | 01/16/19 | bkoep | 2 |
Noc Biologów 2019 | CLOSED | 01/11/19 | 01/12/19 | decu | 15 |
test | CLOSED | 01/11/19 | 01/12/19 | mdziurzynski | 0 |
Otter Gang | CLOSED | 01/15/19 | 01/16/19 | CB19Tuck | 0 |
DU TAR puzzle | CLOSED | 01/23/19 | 02/01/19 | horowsah | 9 |
CHE 8592 Greek Key Challenge 2019 | CLOSED | 01/28/19 | 02/12/19 | jakelmer | 9 |
MGC 2019 - HIV protease | CLOSED | 01/31/19 | 02/06/19 | Ms Jackson | 1 |
MGC 2019 - GTPase RAS | CLOSED | 01/31/19 | 02/06/19 | Ms Jackson | 1 |
P16C8U | CLOSED | 02/01/19 | 02/08/19 | obedes | 1 |
DU chaperone folding puzzle | CLOSED | 02/07/19 | 02/15/19 | horowsah | 9 |
CHE 8592 Greek Key Challenge 2019 v2.0 | CLOSED | 02/11/19 | 02/26/19 | jakelmer | 17 |
Enzymology puzzle | CLOSED | 02/17/19 | 02/22/19 | horowsah | 4 |
Enzymology puzzle 2 | CLOSED | 02/18/19 | 02/22/19 | horowsah | 8 |
freestyle design 40 | CLOSED | 02/27/19 | 03/04/19 | jguerra5 | 1 |
CHE 8592 Greek Key Challenge 2019 v3.0 | CLOSED | 02/27/19 | 03/12/19 | jakelmer | 1 |
CH_410_EC | CLOSED | 01/01/30 | 04/04/19 | ProfCollins | 12 |
Symmetric Trimer Design - 80 segs | CLOSED | 03/06/19 | 04/05/19 | jamiexq | 3 |
Loci's new test contest | CLOSED | 03/08/19 | 04/07/19 | LociOiling | 1 |
DU A-Beta puzzle | CLOSED | 03/09/19 | 03/18/19 | horowsah | 9 |
USTB2019 | CLOSED | 03/11/19 | 04/10/19 | chingsong | 51 |
Greek Key 3.0 | CLOSED | 03/28/19 | 04/27/19 | jakelmer | 1 |
WSC Bioc S19 | CLOSED | 04/08/19 | 04/22/19 | jcnichols | 11 |
hiv | CLOSED | 04/08/19 | 04/30/19 | dbuske | 1 |
EPD 8 Bioinformatica | CLOSED | 04/10/19 | 04/30/19 | agonriv | 2 |
Upo Crazy | CLOSED | 04/11/19 | 04/30/19 | chochito | 0 |
test | CLOSED | 04/30/19 | 05/01/19 | charlottemason | 0 |
Test | CLOSED | 01/01/30 | 04/30/19 | charlottemason | 0 |
SSTU | CLOSED | 04/23/19 | 04/30/19 | tretbutanol | 1 |
Gingivitis | CLOSED | 04/30/19 | 05/30/19 | Aminal88 | 1 |
Itfs-2019 | CLOSED | 04/30/19 | 05/09/19 | ITFS2019 | 1 |
Adisdzik dzik | CLOSED | 05/14/19 | 05/24/19 | stanio | 1 |
An Experiment | CLOSED | 05/15/19 | 05/20/19 | Phil8 | 1 |
ha_test | CLOSED | 05/22/19 | 05/31/19 | bkoep | 2 |
test_scoreboard | CLOSED | 05/22/19 | 05/31/19 | bkoep | 2 |
Festa Scienze 2019 | CLOSED | 06/07/19 | 06/08/19 | abg-2019 | 1 |
23333333abcde qqeeeeeeeq eeq | CLOSED | 06/09/19 | 06/11/19 | njfuzjs | 1 |
233233233 | CLOSED | 06/09/19 | 06/11/19 | ABF | 0 |
TPT_test_puzzle | CLOSED | 06/13/19 | 06/20/19 | bkoep | 10 |
Hemagglutinin Binder Design | CLOSED | 06/13/19 | 06/20/19 | bkoep | 10 |
Come join my constest -Cloudy101 | CLOSED | 06/15/19 | 06/29/19 | Cloudy101 | 1 |
GRC demo | CLOSED | 06/17/19 | 06/22/19 | horowsah | 1 |
DUKE TIP | CLOSED | 06/19/19 | 06/29/19 | buttmanjoe | 2 |
test | CLOSED | 06/24/19 | 06/30/19 | Seth Cooper | 0 |
Private Whitcon | CLOSED | 06/21/19 | 06/24/19 | prolylendopeptidase | 7 |
20aa | CLOSED | 06/27/19 | 06/30/19 | usagi525 | 1 |
Abeta Binder Piecewise | CLOSED | 06/28/19 | 07/27/19 | helen88 | 2 |
text | CLOSED | 06/30/19 | 07/02/19 | pey123456 | 1 |
text2 | CLOSED | 06/30/19 | 07/02/19 | pey123456 | 1 |
JOIN | CLOSED | 07/01/19 | 08/01/19 | helen88 | 5 |
FRIZZLED DESIGN | CLOSED | 07/01/19 | 07/31/19 | helen88 | 3 |
Contest :) | CLOSED | 07/02/19 | 07/03/19 | helen88 | 1 |
Hemagglutinin Binder Design | CLOSED | 07/02/19 | 07/09/19 | bkoep | 2 |
Wiggle Design | CLOSED | 07/02/19 | 07/09/19 | bkoep | 2 |
Backbone Design | CLOSED | 07/02/19 | 07/09/19 | bkoep | 2 |
ORMDL3 | CLOSED | 07/04/19 | 07/09/19 | Michal93 | 1 |
ORMDL3 | CLOSED | 07/03/19 | 07/17/19 | Michal93 | 1 |
l1 | CLOSED | 07/05/19 | 07/31/19 | lnq | 1 |
Hemagglutinin Binder | CLOSED | 07/12/19 | 07/19/19 | bkoep | 4 |
COME JOIN | CLOSED | 07/13/19 | 07/31/19 | Cloudy101 | 1 |
Prova mioglobina | CLOSED | 07/17/19 | 07/18/19 | marcodabramo | 1 |
tested | CLOSED | 07/19/19 | 07/20/19 | horowsah | 1 |
BrainUnwind-ContestD | CLOSED | 07/23/19 | 07/29/19 | PhilippeMarguet | 1 |
Prova | CLOSED | 08/03/19 | 08/04/19 | ikemori | 2 |
Prova 2 | CLOSED | 08/10/19 | 08/15/19 | ikemori | 1 |
PETase Mutants | CLOSED | 08/23/19 | 09/21/19 | RestrictionEndoNykolease | 1 |
PETase | CLOSED | 08/26/19 | 09/23/19 | RestrictionEndoNykolease | 1 |
PETase 1 | CLOSED | 08/26/19 | 09/23/19 | RestrictionEndoNykolease | 1 |
test | CLOSED | 09/06/19 | 09/06/19 | rigidBiscuit | 1 |
test-40 | CLOSED | 09/07/19 | 10/02/19 | fosfotrinucleotide | 1 |
advanced bio | CLOSED | 09/18/19 | 09/19/19 | hardbass | 0 |
F19_CH410_E1 | CLOSED | 09/26/19 | 10/26/19 | ProfCollins | 12 |
Kurenan | CLOSED | 10/05/19 | 10/31/19 | kurenan | 1 |
Bioc WSU Fall 19 | CLOSED | 11/06/19 | 11/24/19 | jcnichols | 20 |
How | CLOSED | 01/01/30 | 12/16/19 | jan.schmue | 1 |
coupe du monde de cinetique | CLOSED | 11/29/19 | 11/30/19 | juanthomas | 3 |
76 aa | CLOSED | 11/30/19 | 12/17/19 | JimHughes | 1 |
Abeta BIOL1300 | CLOSED | 12/09/19 | 12/31/19 | biol1300_nick | 18 |
SEAL MYOGLOBIN BIOL1300 | CLOSED | 12/09/19 | 12/31/19 | biol1300_nick | 18 |
Frizzled Design Puzzle Contest BIOL1300 | CLOSED | 12/09/19 | 12/31/19 | biol1300_nick | 18 |
GTPase Ras Biol1300 | CLOSED | 12/09/19 | 12/31/19 | biol1300_nick | 18 |
Spielwiese | CLOSED | 12/17/19 | 01/16/20 | Bithalbierer | 1 |
Spielwiese Trimer | CLOSED | 12/18/19 | 01/16/20 | Bithalbierer | 1 |
Freestyle Design: | CLOSED | 12/22/19 | 12/28/19 | 01010011111 | 1 |
For Emily | CLOSED | 01/01/20 | 01/10/20 | darron01 | 2 |
Loci's Latest | CLOSED | 01/05/20 | 01/06/20 | LociOiling | 1 |
Loci's design contest | CLOSED | 01/05/20 | 01/06/20 | LociOiling | 1 |
Noc Biologów 2020 | CLOSED | 01/10/20 | 01/11/20 | decu | 15 |
Test | CLOSED | 01/12/20 | 01/13/20 | cassidydobson | 1 |
Chem335 Foldit Assignment | CLOSED | 01/01/30 | 02/19/20 | cassidydobson | 64 |
Fold it Cell Bio 2020 | CLOSED | 01/22/20 | 01/23/20 | CB20HILT | 1 |
Three M contests | CLOSED | 01/24/20 | 01/31/20 | karzan11 | 1 |
MGC 2020 HIV Protease | CLOSED | 01/24/20 | 02/06/20 | Kimbostu | 5 |
Testing | CLOSED | 02/02/20 | 02/28/20 | icaru-5 | 1 |
OSSM Biochemistry | CLOSED | 02/13/20 | 02/28/20 | Brent Richards | 1 |
Test | CLOSED | 02/13/20 | 02/20/20 | bkoep | 0 |
testing | CLOSED | 02/13/20 | 02/14/20 | horowsah | 1 |
proteine0012 | CLOSED | 02/15/20 | 02/18/20 | 01010011111 | 1 |
test contest freestyle variable length | CLOSED | 03/04/20 | 03/06/20 | fornaeffe | 1 |
f | CLOSED | 03/10/20 | 03/11/20 | Makonede | 0 |
Rossman | CLOSED | 03/12/20 | 03/17/20 | mdc_biocat | 0 |
iron core 2 | CLOSED | 03/16/20 | 03/31/20 | fabio | 2 |
test40 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
test41 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
test42 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
test43 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
test44 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
Testing | CLOSED | 01/01/30 | 03/22/20 | Vater_Ashley | 0 |
test45 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
test46 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
test47 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
test48 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
test49 | CLOSED | 03/20/20 | 03/21/20 | horowsah | 1 |
freestyle | CLOSED | 03/22/20 | 03/22/20 | diamonddays | 1 |
test50 | CLOSED | 03/22/20 | 03/23/20 | horowsah | 1 |
test51 | CLOSED | 03/22/20 | 03/23/20 | horowsah | 1 |
test52 | CLOSED | 03/22/20 | 03/23/20 | horowsah | 1 |
test53 | CLOSED | 03/22/20 | 03/23/20 | horowsah | 1 |
test54 | CLOSED | 03/22/20 | 03/23/20 | horowsah | 1 |
test55 | CLOSED | 03/22/20 | 03/23/20 | horowsah | 1 |
thisisatest | CLOSED | 03/22/20 | 03/23/20 | tolili | 1 |
test56 | CLOSED | 03/24/20 | 03/25/20 | horowsah | 1 |
test57 | CLOSED | 03/24/20 | 03/25/20 | horowsah | 1 |
test58 | CLOSED | 03/27/20 | 03/28/20 | horowsah | 1 |
ZNF148 | CLOSED | 03/27/20 | 04/24/20 | charkie | 1 |
ZNF148 Mutant | CLOSED | 03/27/20 | 04/22/20 | charkie | 1 |
Fusion Protien | CLOSED | 03/30/20 | 04/28/20 | JustinRothganger | 1 |
we can is can | CLOSED | 03/31/20 | 04/02/20 | RealFailure | 2 |
SP20_CH410_E1 | CLOSED | 01/01/30 | 05/01/20 | ProfCollins | 6 |
rafes test | CLOSED | 04/02/20 | 04/03/20 | rafe_barratt | 1 |
DU Hydrogen Bonding Puzzle | CLOSED | 04/02/20 | 04/08/20 | horowsah | 8 |
Primary Structure Contest | CLOSED | 04/08/20 | 04/20/20 | horowsah | 7 |
Fight HIV | CLOSED | 04/12/20 | 05/10/20 | theRadOnKid2 | 1 |
EC Contest CH410 Spring 20 | CLOSED | 04/13/20 | 05/03/20 | jcnichols | 14 |
For RGPU (Herzen) | CLOSED | 04/17/20 | 04/30/20 | Gametofit | 4 |
good name | CLOSED | 04/22/20 | 04/26/20 | lazaros | 1 |
a good contest name | CLOSED | 04/22/20 | 05/03/20 | DrAHou | 11 |
test59 | CLOSED | 04/23/20 | 04/24/20 | horowsah | 1 |
test60 | CLOSED | 04/23/20 | 04/24/20 | horowsah | 1 |
test61 | CLOSED | 04/23/20 | 04/24/20 | horowsah | 1 |
test63 | CLOSED | 04/23/20 | 04/24/20 | horowsah | 1 |
test64 | CLOSED | 04/23/20 | 04/24/20 | horowsah | 1 |
DU Proteins S20 a-helix | CLOSED | 04/23/20 | 04/27/20 | horowsah | 1 |
DU Proteins S20 B-sheet Contest | CLOSED | 04/23/20 | 04/27/20 | horowsah | 7 |
DU Proteins S20 a-helix (2) | CLOSED | 04/23/20 | 04/29/20 | horowsah | 7 |
Proteins S20 B-sheet (2) | CLOSED | 04/23/20 | 04/29/20 | horowsah | 7 |
temp000001 | CLOSED | 04/23/20 | 04/24/20 | yduan | 0 |
Freestyle Design | CLOSED | 04/25/20 | 05/24/20 | Bruno Kestemont | 2 |
DU S20 Tertiary Structure | CLOSED | 04/28/20 | 05/06/20 | horowsah | 7 |
DU S20 Folding Pathway | CLOSED | 04/30/20 | 05/06/20 | horowsah | 7 |
Piecing The Puzzle (sandbox) | CLOSED | 05/03/20 | 06/01/20 | Puttering | 1 |
HIV Protease (sandbox) | CLOSED | 05/03/20 | 06/01/20 | Puttering | 1 |
sample 2 | CLOSED | 05/06/20 | 05/07/20 | coolscience | 0 |
test65 | CLOSED | 05/10/20 | 05/11/20 | horowsah | 1 |
DU S20 IgG Contest | CLOSED | 05/10/20 | 05/15/20 | horowsah | 7 |
Beginner COVID Puzzle | CLOSED | 05/12/20 | 05/31/20 | Vater_Ashley | 2 |
test_contest_200512 | CLOSED | 05/12/20 | 05/19/20 | bkoep | 2 |
GTPase Ras | CLOSED | 05/17/20 | 06/16/20 | evifnoskcaj | 1 |
test64 | CLOSED | 05/18/20 | 05/19/20 | horowsah | 1 |
test65 | CLOSED | 05/18/20 | 05/19/20 | horowsah | 1 |
Josh's Freestyle Design | CLOSED | 05/19/20 | 05/31/20 | joshmiller | 1 |
test2 | CLOSED | 05/22/20 | 05/29/20 | jflat06 | 1 |
HIV Protease | CLOSED | 05/27/20 | 06/26/20 | evifnoskcaj | 1 |
Ligand test | CLOSED | 05/27/20 | 06/05/20 | mleon059 | 1 |
Freestyle Design | CLOSED | 05/31/20 | 06/30/20 | neutralgreen | 0 |
Freestyle Design | CLOSED | 05/31/20 | 06/30/20 | neutralgreen | 0 |
Proteins S20 Zymogen | CLOSED | 05/31/20 | 06/05/20 | horowsah | 7 |
Freestyle Design: Varaible Length | CLOSED | 06/03/20 | 07/03/20 | janFa204 | 1 |
COVID-19 Proteins S20 | CLOSED | 06/03/20 | 06/09/20 | horowsah | 5 |
Test2 | CLOSED | 06/10/20 | 06/11/20 | bmeg102ubc@gmail.com | 1 |
HIV test | CLOSED | 06/10/20 | 06/11/20 | bmeg102ubc@gmail.com | 1 |
Heme Puzzle | CLOSED | 06/15/20 | 06/16/20 | bmeg102ubc@gmail.com | 1 |
Cyclin D3 isoforms | CLOSED | 06/16/20 | 06/23/20 | mmartinezsolorzano | 1 |
Heme Test | CLOSED | 06/20/20 | 06/30/20 | bmeg102ubc@gmail.com | 1 |
Carbon Nanotube Enzyme | CLOSED | 06/23/20 | 07/23/20 | JustinRothganger | 1 |
Testing Purposes | CLOSED | 06/28/20 | 07/05/20 | bmeg102ubc@gmail.com | 1 |
Testing Purposes 2 | CLOSED | 06/28/20 | 07/05/20 | bmeg102ubc@gmail.com | 1 |
Testing Purposes 2 | CLOSED | 06/28/20 | 07/05/20 | bmeg102ubc@gmail.com | 1 |
HIV protease test | CLOSED | 07/02/20 | 08/01/20 | evifnoskcaj | 6 |
Test GTPase Ras | CLOSED | 07/02/20 | 08/01/20 | evifnoskcaj | 1 |
mGPR124 Full ECR | CLOSED | 07/10/20 | 08/07/20 | EthanDintzner | 1 |
HIV | CLOSED | 07/10/20 | 07/17/20 | MarioJ | 1 |
Testing | CLOSED | 07/12/20 | 07/15/20 | bmeg102ubc@gmail.com | 0 |
2018 kindai lifescience | CLOSED | 07/13/20 | 07/21/20 | kazuho777 | 1 |
test67 | CLOSED | 07/15/20 | 07/16/20 | horowsah | 1 |
Project 1 Molecular Interaction Mystery | CLOSED | 07/15/20 | 08/14/20 | bmeg102ubc@gmail.com | 1 |
TryDNAzyme | CLOSED | 07/16/20 | 07/17/20 | YJTocre | 1 |
Session 2 Project 2 | CLOSED | 07/18/20 | 08/17/20 | bmeg102ubc@gmail.com | 1 |
Heme-myoglobin complex problem | CLOSED | 07/23/20 | 08/22/20 | bmeg102ubc@gmail.com | 1 |
Yeet | CLOSED | 07/29/20 | 08/03/20 | meoWs | 0 |
Freestyle variable length | CLOSED | 08/03/20 | 08/31/20 | esummers | 1 |
Barnase Ribonuclease | CLOSED | 08/05/20 | 09/04/20 | esummers | 3 |
JMtest | CLOSED | 08/15/20 | 08/16/20 | BioMug | 1 |
OSSM Contest | CLOSED | 08/18/20 | 08/19/20 | Cade.B | 2 |
OSSM Biochem Contest | CLOSED | 08/18/20 | 08/20/20 | Cade.B | 2 |
myoglobin test | CLOSED | 08/19/20 | 08/22/20 | BioMug | 1 |
HIV contest test | CLOSED | 08/19/20 | 08/22/20 | BioMug | 1 |
test | CLOSED | 08/21/20 | 08/22/20 | horowsah | 1 |
test | CLOSED | 01/01/30 | 08/31/20 | dhaos voz | 1 |
nsp-6mer-v3 | CLOSED | 08/26/20 | 08/31/20 | BioMug | 2 |
testing | CLOSED | 08/27/20 | 08/28/20 | bmeg102ubc@gmail.com | 1 |
Plant bio | CLOSED | 08/31/20 | 09/29/20 | Dora2199 | 1 |
Primary Structure | CLOSED | 09/01/20 | 09/08/20 | BeckWSU666 | 1 |
CHEM324 Mann 2020 | CLOSED | 09/01/20 | 09/30/20 | mannf_uwp | 0 |
Curry Cell Bio | CLOSED | 09/02/20 | 09/03/20 | Brendon Kelley | 0 |
Contest Contest11 on on | CLOSED | 09/02/20 | 09/25/20 | 01010011111 | 1 |
1111 11111 | CLOSED | 09/06/20 | 10/04/20 | m.dyakova | 1 |
22222 222222 | CLOSED | 09/08/20 | 10/08/20 | m.dyakova | 1 |
Seal Myoglobin - Ligand Puzzle | CLOSED | 09/08/20 | 09/30/20 | Formula350 | 1 |
INFa | CLOSED | 09/10/20 | 09/30/20 | Xu2020 | 1 |
Lets get it Brad | CLOSED | 09/10/20 | 09/11/20 | Jonbosss | 3 |
DU F20 Proteins: Hydrogen Bonding | CLOSED | 09/17/20 | 09/23/20 | horowsah | 70 |
erw | CLOSED | 09/18/20 | 09/30/20 | corrinavirus | 1 |
DU F20 Proteins: Primary Structure | CLOSED | 09/22/20 | 10/05/20 | horowsah | 70 |
boi that's wittig | CLOSED | 09/24/20 | 09/25/20 | tanjhent | 2 |
froga | CLOSED | 09/23/20 | 10/23/20 | arri96 | 1 |
App Experimentation Testing | CLOSED | 09/27/20 | 10/11/20 | Jumper2 | 1 |
Barnase for BIOMO201 | CLOSED | 09/30/20 | 10/30/20 | emma_summers | 3 |
test | CLOSED | 10/01/20 | 10/02/20 | chryu | 2 |
frizzled maroon test | CLOSED | 10/03/20 | 10/31/20 | CatSari | 1 |
seal myo test | CLOSED | 10/03/20 | 10/31/20 | CatSari | 1 |
abeta test | CLOSED | 10/03/20 | 10/31/20 | CatSari | 1 |
DU Fall 20 Proteins: Alpha Helix | CLOSED | 10/07/20 | 10/14/20 | horowsah | 70 |
DU Fall 20 Proteins: Beta Sheet | CLOSED | 10/07/20 | 10/14/20 | horowsah | 70 |
DU Fall20 Proteins: Tertiary Structure | CLOSED | 10/12/20 | 10/23/20 | horowsah | 70 |
DU Fall 20 Proteins: Folding Pathway 1 | CLOSED | 10/15/20 | 10/23/20 | horowsah | 70 |
DU Fall 20 Proteins: Folding Pathway 2 | CLOSED | 10/15/20 | 10/23/20 | horowsah | 70 |
test | CLOSED | 10/16/20 | 10/17/20 | horowsah | 1 |
App Experimentation Testing 2 | CLOSED | 01/01/30 | 11/08/20 | Jumper2 | 1 |
Prueba1 | CLOSED | 10/17/20 | 10/18/20 | frafer_udl | 1 |
freestyle competition | CLOSED | 10/21/20 | 11/10/20 | Someone1212 | 1 |
test | CLOSED | 10/20/20 | 10/21/20 | joshmiller | 1 |
another test | CLOSED | 10/24/20 | 10/31/20 | Enzyme | 1 |
Vegane Hot Dogs | CLOSED | 10/25/20 | 11/01/20 | r1chi | 1 |
DU Fall 20 Proteins: IgG | CLOSED | 10/26/20 | 11/04/20 | horowsah | 70 |
test | CLOSED | 10/26/20 | 10/31/20 | joshmiller | 2 |
aflatest | CLOSED | 10/29/20 | 10/31/20 | bkoep | 0 |
BQ2020_1 | CLOSED | 10/31/20 | 11/01/20 | frafer_udl | 2 |
BQ2020_2 | CLOSED | 10/31/20 | 11/01/20 | frafer_udl | 1 |
BQ2020_3 | CLOSED | 10/31/20 | 11/01/20 | frafer_udl | 1 |
DU Fall 20: Chymotrypsin | CLOSED | 11/03/20 | 11/13/20 | horowsah | 70 |
SealMyogloblin | CLOSED | 11/04/20 | 11/05/20 | frafer_udl | 1 |
Frizzled | CLOSED | 11/04/20 | 11/05/20 | frafer_udl | 1 |
TwentyAA | CLOSED | 11/04/20 | 11/05/20 | frafer_udl | 1 |
CH410 EC | CLOSED | 11/04/20 | 11/22/20 | jcnichols | 9 |
Mioglobina de foca | CLOSED | 11/05/20 | 11/24/20 | frafer_udl | 54 |
DiseƱa con Frizzled | CLOSED | 11/05/20 | 11/24/20 | frafer_udl | 53 |
FA20 CH410 EC | CLOSED | 01/01/30 | 12/09/20 | ProfCollins | 5 |
splash | CLOSED | 11/15/20 | 11/16/20 | chryu | 13 |
DU Fall 20 Proteins: Zymogen | CLOSED | 11/14/20 | 11/20/20 | horowsah | 68 |
myotoxin a inhibition | CLOSED | 11/15/20 | 11/18/20 | collinwright | 1 |
Barnase BIOMO201-3 | CLOSED | 11/15/20 | 12/15/20 | emma_summers | 2 |
HIV protease contest | CLOSED | 11/16/20 | 11/27/20 | AmelieFolding | 47 |
DU Fall 20 Proteins: Spike binder | CLOSED | 11/19/20 | 11/28/20 | horowsah | 21 |
HIV protease contest | CLOSED | 11/22/20 | 11/24/20 | hiram2 | 1 |
fail test | CLOSED | 11/24/20 | 11/26/20 | bkoep | 1 |
second test fail | CLOSED | 11/24/20 | 11/27/20 | bkoep | 1 |
UGent_Freestyle | CLOSED | 11/24/20 | 12/18/20 | mdc_biocat | 36 |
UGent_Aflatoxin | CLOSED | 11/24/20 | 12/18/20 | mdc_biocat | 2 |
UGENT | CLOSED | 11/24/20 | 12/18/20 | mdc_biocat | 1 |
test | CLOSED | 11/26/20 | 11/27/20 | Sonak | 1 |
test | CLOSED | 11/26/20 | 11/27/20 | Sonak | 1 |
2016114990 | CLOSED | 11/26/20 | 11/27/20 | Sonak | 1 |
2016114990 | CLOSED | 11/26/20 | 11/27/20 | Sonak | 1 |
4tmv4 | CLOSED | 11/25/20 | 11/26/20 | simmsj3 | 1 |
HIV protease | CLOSED | 11/30/20 | 12/04/20 | 2019115246 | 1 |
DUchymofall2 | CLOSED | 12/01/20 | 12/08/20 | horowsah | 2 |
DU zymo 2 | CLOSED | 12/01/20 | 12/08/20 | horowsah | 2 |
UGENT_Freestyle 2 | CLOSED | 12/15/20 | 12/16/20 | mdc_biocat | 2 |
A contest | CLOSED | 12/28/20 | 01/27/21 | EasonSue | 1 |
liu yang | CLOSED | 12/31/20 | 01/28/21 | EasonSue | 1 |
python class work | CLOSED | 12/31/20 | 01/28/21 | EasonSue | 1 |
Bienvenito | CLOSED | 12/31/20 | 01/30/21 | Businge Thierry | 1 |
abeta | CLOSED | 01/21/21 | 01/25/21 | JlopezYU | 1 |
amyloid beta test | CLOSED | 01/26/21 | 02/25/21 | JlopezYU | 1 |
ASA_Challenge | CLOSED | 01/29/21 | 02/03/21 | oliver_asa | 11 |
Test1 | CLOSED | 01/30/21 | 01/31/21 | simmsj3 | 1 |
GTPase Ras | CLOSED | 01/01/30 | 02/14/21 | Sara Gomez | 1 |
CD81 | CLOSED | 02/02/21 | 03/01/21 | simmsj3 | 1 |
B2aR | CLOSED | 02/03/21 | 02/28/21 | simmsj3 | 6 |
Greek Key Challenge | CLOSED | 02/02/21 | 03/02/21 | jakelmer | 22 |
MOTIF BUILDER | CLOSED | 02/16/21 | 02/17/21 | LittleRibosome | 1 |
test1 | CLOSED | 02/25/21 | 02/28/21 | danirahman | 1 |
TEST | CLOSED | 02/27/21 | 02/28/21 | nyarcth | 1 |