Log in to Create Template Contest

All Contests (Only Show Open Contests)

Name	Status	Start Date	End Date	Owner	Players
test 2	OPEN	05/24/11	12/31/29	gurch	1
Freestyle Design 80	OPEN	09/15/13	09/15/20	Sadler	1
Freestyle Design 40	OPEN	03/02/16	11/23/21	khendarg	1
Freestyle Design 20	OPEN	03/02/16	01/01/30	khendarg	1
SK VII	OPEN	02/02/17	12/31/20	ScratchKid	1
Twelver	OPEN	02/12/17	12/31/20	ScratchKid	1
erj	OPEN	02/12/17	12/31/20	ScratchKid	1
Contest Template Test and testing	OPEN	01/01/30	04/04/20	lansefeixue	1
hello world	OPEN	01/01/30	04/04/20	shan11	1
sample 1	OPEN	01/01/30	04/04/20	walid.alitani	1
BIOL490	OPEN	01/01/30	04/04/20	epetruc	18
ZNF148	OPEN	03/27/20	04/24/20	charkie	1
ZNF148 Mutant	OPEN	03/27/20	04/22/20	charkie	1
Fusion Protien	OPEN	03/30/20	04/28/20	JustinRothganger	1
SP20_CH410_E1	OPEN	01/01/30	05/01/20	ProfCollins	1
DU Hydrogen Bonding Puzzle	OPEN	04/02/20	04/08/20	horowsah	8
40 Seg Design Contest	CLOSED	04/15/10	04/20/10	TheGUmmer	3
testing the contest	CLOSED	04/15/10	05/15/10	mat747	3
Another Contest	CLOSED	04/17/10	04/22/10	TheGUmmer	2
'Brave New World' Class Puzzle	CLOSED	04/22/10	05/02/10	beta_helix	25
Sandbox puzzle for CASP9	CLOSED	05/02/10	05/19/10	beta_helix	22
protein to test scripts	CLOSED	05/22/10	12/31/10	smith92clone	1
CASP9 611 residue	CLOSED	05/29/10	06/15/10	Mark-	4
test test	CLOSED	05/29/10	05/30/10	CharlieFortsConscience	1
Recipe tester	CLOSED	05/31/10	07/01/10	Datstandin	2
Simpler recipe tester	CLOSED	05/31/10	06/30/10	Datstandin	2
Script tester - Design	CLOSED	01/01/30	05/24/13	Krog	1
Beginner puzzle copy	CLOSED	05/31/10	05/18/12	Krog	1
Even simpler recipe tester	CLOSED	05/31/10	06/30/10	Datstandin	1
20 seg script test	CLOSED	06/05/10	12/31/10	srssmith92	1
Crashguard303 Script test	CLOSED	06/07/10	06/14/10	Crashguard303	3
aendgraend tested contests	CLOSED	06/09/10	06/13/10	aendgraend	1
assasa	CLOSED	06/10/10	06/11/10	yjh	1
565645646	CLOSED	06/11/10	06/12/10	yjh	0
zzzzzzzzz	CLOSED	06/10/10	06/11/10	yjh	0
New small test	CLOSED	06/17/10	07/30/10	Crashguard303	4
The Beginner contest	CLOSED	06/24/10	06/30/10	Gebauer	1
Test area	CLOSED	06/24/10	12/31/10	mat747	1
Test area - HIV protease	CLOSED	06/24/10	12/31/10	mat747	1
Freestyle 80 for a month	CLOSED	06/25/10	07/31/10	sehskyle	1
Script tester 2	CLOSED	07/04/10	07/05/12	Krog	1
Script tester 3	CLOSED	07/04/10	07/08/11	Krog	0
Script tester 3	CLOSED	07/04/10	07/08/11	Krog	1
find the various aminos	CLOSED	07/06/10	12/31/10	smith92clone	2
M	CLOSED	07/05/10	07/31/13	RoboMonkey	1
asdfadf	CLOSED	07/05/10	07/29/10	RoboMonkey	1
a	CLOSED	07/11/10	07/25/10	asianboy26	1
80segment	CLOSED	07/12/10	07/31/10	asianboy26	1
a.l	CLOSED	07/13/10	07/15/10	asianboy26	1
hiv protease	CLOSED	07/11/10	07/17/10	asianboy26	1
GTPase	CLOSED	07/11/10	08/31/10	Jordandk	1
40 segment	CLOSED	07/16/10	07/18/10	icreatemac	0
math modeling	CLOSED	07/16/10	07/29/12	themarquis	1
Anyone Can Join (freestyle design 80)	CLOSED	07/19/10	07/18/11	spy club	202
Contest name goes here?	CLOSED	08/02/10	08/05/10	oakwhiz	1
ygkas2	CLOSED	08/11/10	08/11/11	sotk	0
Script test III	CLOSED	08/12/10	10/12/10	Crashguard303	6
Phalpha1beta	CLOSED	08/14/10	08/15/10	mvackel	1
Align-it	CLOSED	08/14/10	08/21/10	Arbot360	20
CD44 protein	CLOSED	08/14/10	08/24/10	mikedressner	1
The science is pure science	CLOSED	08/15/10	08/21/10	Dj-P	1
the grand final	CLOSED	08/17/10	12/31/13	cyclic3	2
ygkas	CLOSED	08/13/13	08/17/14	sotk	2
GTPase Ras	CLOSED	08/18/10	08/31/10	cyclic3	1
Let's Cure Cancer Finally	CLOSED	08/18/10	12/31/13	mikedressner	691
1	CLOSED	08/19/10	08/31/10	lipasesucks	1
12	CLOSED	08/19/10	08/31/10	lipasesucks	1
test	CLOSED	08/19/10	08/20/10	beta_helix	1
HiV try	CLOSED	08/20/10	09/20/10	Pyotr	1
Test	CLOSED	08/21/10	08/23/10	Acida-2	1
HIV fight!	CLOSED	08/22/10	08/31/10	Rav3n_pl	29
Freestyle Design 80	CLOSED	08/21/10	10/31/10	Handful	1
motor protein tail	CLOSED	08/23/10	08/23/11	ceventer	1
ygkas 1-80	CLOSED	08/23/10	08/23/11	sotk	1
One last CASP9 Target!	CLOSED	08/25/10	09/28/10	beta_helix	74
Calzolai	CLOSED	09/01/10	11/08/10	iRob	0
ygkas1 40-120	CLOSED	08/26/10	08/26/11	sotk	1
Target 611 - Test	CLOSED	08/29/10	08/30/10	Cyanoia	1
BattleGrounds....v.5655.88	CLOSED	08/31/10	08/24/13	InsaneGamer1457	1
my contest	CLOSED	09/01/10	09/02/10	marissa101	0
Loss Cancer	CLOSED	08/31/10	12/31/10	FalconDeOro	1
Aids Security	CLOSED	09/02/10	01/22/11	Gaara	1
Test Range- HIV Lab	CLOSED	09/01/10	09/05/10	buddy1018	1
xz 07 biotechnology	CLOSED	09/02/10	12/31/10	xuchenidea	0
bonebreake	CLOSED	09/09/10	09/17/10	baeda	1
Dubons Class Contest	CLOSED	09/08/10	09/10/10	dubon1	2
Giordano's Class	CLOSED	09/09/10	09/13/10	cgiordano	0
BP's 611	CLOSED	09/10/10	09/11/10	Bletchley Park	1
PhAlpha1Beta	CLOSED	09/12/10	09/13/10	mvackel	1
PhAlpha1Beta	CLOSED	09/12/10	09/15/10	mvackel	1
Contest10000G1	CLOSED	09/14/10	10/01/10	crispy fry	1
slither	CLOSED	09/16/10	12/31/13	missb	0
HIV protease	CLOSED	09/17/10	09/18/10	skoddet1	20
best score	CLOSED	09/17/10	09/21/10	Willbee	1
test	CLOSED	09/19/10	09/20/10	rangerQ	1
easy!!!! :o)	CLOSED	10/01/10	12/31/13	yomama	0
Bioinfor Kaset	CLOSED	09/19/10	09/27/10	kiattawee	17
Fold It (or else)	CLOSED	09/20/10	09/26/10	Zeff	0
Fold It (or else)	CLOSED	09/20/10	09/26/10	Zeff	0
Long Contest	CLOSED	09/20/10	01/01/12	maquiladora	1
free style 500	CLOSED	09/20/10	10/31/10	ethanIc	1
Script Test IV	CLOSED	09/21/10	01/31/11	Crashguard303	1
Acida's test	CLOSED	09/22/10	09/30/10	Acida-2	15
mva1alpha	CLOSED	09/22/10	09/21/11	mvackel	1
AP BIO Extra Credit	CLOSED	09/24/10	09/25/10	jesalomone11	6
Superkittyhorse proteins	CLOSED	09/27/10	12/31/10	avapenny	1
Need structure	CLOSED	09/29/10	10/10/10	canikickit49	1
Alignment	CLOSED	10/02/10	12/31/10	sielenk	1
Alignment	CLOSED	10/02/10	12/31/10	sielenk	0
bjarke join mig	CLOSED	10/04/10	10/05/10	aske2010	2
AATG TK Bioteknologi	CLOSED	10/04/10	10/08/10	thomas.holm@gmail.com	1
random test	CLOSED	10/12/10	12/31/10	Ryanfav	1
Beta-carotene dioxygenase	CLOSED	10/13/10	11/05/10	mbarnkob	0
kanya	CLOSED	10/14/10	10/26/10	g5314401673	1
khc test	CLOSED	10/14/10	10/14/11	ceventer	1
prueba 1x	CLOSED	10/22/10	11/11/10	rascuacho	0
Test	CLOSED	10/15/10	10/16/10	Pyrohmstr	1
Test	CLOSED	10/15/10	10/23/10	Pyrohmstr	1
Freestyle Design 80	CLOSED	10/17/10	10/01/11	BlueRabit	1
meh	CLOSED	10/17/10	10/31/10	anthunk	1
GFP	CLOSED	10/18/10	10/30/10	Pyrohmstr	1
GFP	CLOSED	10/18/10	10/30/10	Pyrohmstr	0
GFP1	CLOSED	10/18/10	10/30/10	Pyrohmstr	1
Script test ligand	CLOSED	10/20/10	01/31/11	Crashguard303	4
P1a1b	CLOSED	10/22/10	10/21/11	mvackel	1
SEAL MYOGLOBIN	CLOSED	10/23/10	10/30/10	samwitus	0
niep	CLOSED	10/24/10	10/26/10	niep0329	1
CASP9 Target 611	CLOSED	10/24/10	11/30/10	cd11	1
test	CLOSED	10/25/10	10/31/13	centic	1
XY	CLOSED	10/28/10	10/29/10	PdB24	1
Freestyle for all	CLOSED	11/01/10	12/05/10	thosi	3
Beginner Alignment puzzle	CLOSED	11/04/10	11/11/10	science.nerd	0
Foldit University Challenge	CLOSED	11/05/10	11/19/10	ilya.makedon	47
PdB24	CLOSED	11/05/10	02/01/11	PdB24	0
PdB24	CLOSED	11/05/10	02/01/11	PdB24	1
Alabudzki	CLOSED	11/06/10	12/31/10	alabudzki	1
MRMAND123	CLOSED	11/09/11	11/09/12	MR MAN D	1
hard	CLOSED	11/13/10	12/31/10	marshin	1
hiv	CLOSED	11/12/10	01/16/11	marshin	1
hotu	CLOSED	11/12/10	11/30/10	marshin	1
SKHJGFDRSKL	CLOSED	11/12/10	11/30/10	marshin	1
Design a protein	CLOSED	11/18/10	12/18/10	svenskhan	1
Open University Challenge	CLOSED	11/20/10	12/18/10	ilya.makedon	2
Free Challenge for University Students	CLOSED	11/18/10	12/18/10	ilya.makedon	0
Daddy's	CLOSED	11/30/10	12/25/10	TheDaddyTired	0
seal myoglobin	CLOSED	12/01/10	12/01/12	traywright	1
Sandbox-40	CLOSED	12/01/10	12/02/10	kevinjh	1
Unl. Sandbox	CLOSED	12/02/10	12/31/10	kevinjh	1
'for everyone	CLOSED	12/04/10	01/09/11	anthunk	67
Grand master rival challenge	CLOSED	01/01/11	12/31/11	Malzarg	0
BiChE Easy puzzle	CLOSED	12/08/10	12/10/10	ejf3c	1
AIDS	CLOSED	12/08/10	12/31/11	colonelpaco	1
Freestyle Design 500	CLOSED	12/09/10	12/12/10	MHannigan	1
Fun	CLOSED	12/12/10	12/31/10	bost29	1
Alignment battle	CLOSED	12/12/10	12/31/10	Nikaeo	4
Large Protein Test	CLOSED	12/14/10	12/15/10	Gray Thomas	1
Pedobacter Beta Barrel	CLOSED	12/14/10	12/25/10	Gray Thomas	1
Freestyle Design this 500 residue protein - Seagat2011	CLOSED	12/17/10	01/14/12	Seagat2011	50
??	CLOSED	12/20/10	01/01/11	reedbc	1
HIV Crash test	CLOSED	12/21/10	12/31/11	Dr Tyrell	1
Freestyle Multi-start 499.9	CLOSED	12/22/10	01/01/11	Dj-P	1
AT Testing	CLOSED	12/22/10	12/26/10	anthunk	1
FreestyleBKG	CLOSED	12/22/10	12/31/13	aricc	1
AT Testing Too	CLOSED	12/22/10	12/26/10	anthunk	1
Why not, really?	CLOSED	12/22/10	01/22/11	anthunk	10
Beginning Alignment Puzzle	CLOSED	02/04/11	02/12/11	ltchong	0
CHEM 1460 Puzzle	CLOSED	02/04/11	02/12/11	ltchong	1
CHEM 1460 Puzzle 2	CLOSED	02/04/11	02/11/11	ltchong	1
FOLD Championship	CLOSED	12/23/10	12/31/10	Dj-P	1
GTPase Ras 1.0	CLOSED	12/23/10	12/31/10	Dj-P	1
F20 for testing	CLOSED	12/24/10	02/28/11	Rav3n_pl	8
Twisting of the protein (v1.0)	CLOSED	12/28/10	04/15/11	Dj-P	11
Twisting of the protein (v.2)	CLOSED	01/01/11	01/31/11	Dj-P	5
CASP 9: Nycticorax nycticorax's mystery.	CLOSED	01/01/11	01/15/11	Dj-P	14
HIV protease	CLOSED	01/02/11	01/01/12	maksimlekler	1
Beginner Alignment Puzzle	CLOSED	01/02/11	01/01/12	maksimlekler	1
CASP training puzzle	CLOSED	01/02/11	01/01/12	maksimlekler	1
CASP9 Target 611 residue protein	CLOSED	01/02/11	01/01/12	maksimlekler	1
CASP9 target Design?	CLOSED	01/02/11	01/01/12	maksimlekler	1
SEAL MYOGLOBIN	CLOSED	01/02/11	01/01/12	maksimlekler	1
Contest Template Test	CLOSED	01/02/11	01/01/12	maksimlekler	1
Histone H1	CLOSED	01/03/11	01/31/11	Dj-P	4
Blank	CLOSED	01/04/11	12/31/11	kevinjh	1
LUA test	CLOSED	01/05/11	01/30/11	Dj-P	1
test	CLOSED	01/05/11	01/06/11	omelet bob	1
test	CLOSED	01/05/11	01/06/11	omelet bob	1
Test	CLOSED	01/06/11	01/13/11	Roedl	1
Threading	CLOSED	01/06/11	01/13/11	AmyLia330	1
Halobacterium NRC-1 Hypothetical Protein	CLOSED	01/08/11	05/31/11	pramodbhat	1
Pass the Thyme	CLOSED	01/09/11	02/28/11	TheGUmmer	1
HIV protease	CLOSED	01/09/11	12/31/14	Alegend45	1
Freestyle Design Variable Length	CLOSED	01/09/11	01/01/12	ten04031977	1
mine silly	CLOSED	01/17/11	12/31/11	anthunk	1
Laccase	CLOSED	01/19/11	01/23/11	El_Crazy_Xabi	1
Bioc670_1	CLOSED	01/22/11	02/10/11	bkuhlman	24
BioContest	CLOSED	01/27/11	01/28/11	cbehling	2
Black box42	CLOSED	02/09/11	02/11/11	DaVinci21	1
HIV's end	CLOSED	02/13/11	12/31/14	Dj-P	305
binding motif test	CLOSED	02/16/11	02/03/12	ceventer	1
Dj-P's duel puzzle	CLOSED	02/17/11	02/18/11	Dj-P	1
SBG	CLOSED	02/18/11	02/19/11	crma	3
god berry	CLOSED	02/18/11	03/12/11	My Cranky Panda	1
first	CLOSED	02/20/11	12/31/11	jojotastic777	1
Truncated human ryanodine receptor 2	CLOSED	02/21/11	05/31/11	Fnallerdaller	1
2011-11 small Freestyle	CLOSED	02/22/11	12/31/11	Crashguard303	4
Truncated Human Ryanodine Receptor 2 v2	CLOSED	02/22/11	05/29/11	Fnallerdaller	1
first	CLOSED	02/25/11	12/31/11	alex2011	1
Time to Cure Cancer- Once and For All!	CLOSED	03/01/11	06/01/11	tyler0911	12
CASP9 targed Design test, all welcome	CLOSED	03/01/11	07/01/11	tyler0911	1
bugster	CLOSED	03/05/11	04/30/11	alex2011	1
The AS challenge	CLOSED	03/31/11	04/17/11	AgentScience	0
Chem 2225 Spring 2011 Contest	CLOSED	03/09/11	03/31/11	brian.parker	7
Chem 1307 Spring 2011 Contest	CLOSED	03/09/11	03/31/11	brian.parker	13
tinglei	CLOSED	03/09/11	03/10/11	tinglei711	0
Pregnancy Associated Plasma Protein (PAPP-A)	CLOSED	03/12/11	08/15/11	meschruhms	1
CRAZY	CLOSED	03/12/11	03/17/11	alex2011	1
contest	CLOSED	03/19/11	05/22/11	protein123	1
biol200-3-23-11	CLOSED	04/04/11	04/09/11	gabhsa	12
Sheet Banding Trick	CLOSED	03/21/11	04/30/11	itskimo	0
etrg	CLOSED	03/26/11	12/31/14	oxyi	0
etrg	CLOSED	03/26/11	12/31/14	oxyi	0
etrg	CLOSED	03/26/11	12/31/14	oxyi	0
lv.1	CLOSED	03/28/11	04/03/11	Marco Chan	1
Beginners game	CLOSED	04/11/11	04/17/11	Zsolesz84	0
khc head	CLOSED	04/13/11	04/20/13	ceventer	0
kk's contest	CLOSED	04/20/11	04/30/11	kkwizard101	1
Freestyle Design: Variable Length	CLOSED	04/28/11	05/31/11	Acida-2	1
Freestyle Design 500	CLOSED	04/28/11	05/31/11	Acida-2	4
SEAL MYOGLOBIN	CLOSED	04/28/11	05/31/11	Acida-2	1
Ligand Folding Practice- Open to all	CLOSED	05/01/11	09/01/11	tyler0911	23
HIV protease sandbox	CLOSED	05/04/11	05/01/14	tyler0911	49
more testing	CLOSED	05/04/11	12/31/14	anthunk	1
Easy first alignment	CLOSED	05/09/11	05/31/11	serico7	1
Ykl071w Amino acid sequence	CLOSED	05/09/11	05/31/11	Dendroid	1
the only tournament here! (for now)	CLOSED	05/10/11	06/10/11	shrock	2
vhcvhvghgvhjhghjhgjkjyhjgjhjkhkjyh	CLOSED	05/18/11	05/19/11	oxyi	1
dhtrjkg vbuibmjjmknv n bogf bjh mknknb	CLOSED	05/18/11	05/19/11	oxyi	1
dhtrjkg vbuibmjjmknv n bogf bjh mknkn	CLOSED	05/18/11	05/19/14	oxyi	1
dhtrjkg vbuibmjjmknv n bogf bjh mknkn	CLOSED	05/18/11	05/19/14	oxyi	1
576i	CLOSED	05/21/11	12/31/14	oxyi	1
test	CLOSED	05/24/11	12/31/19	gurch	237
fbdfnbdgn	CLOSED	05/23/11	12/31/14	oxyi	1
Ligand Practice	CLOSED	05/24/11	09/11/11	tyler0911	3
HIV protease contest!	CLOSED	05/29/11	05/31/11	chouti	1
The unbreakable Loops	CLOSED	05/30/11	09/22/11	lukis	0
Test	CLOSED	06/04/11	06/11/11	Zeljko	1
Test2	CLOSED	06/10/11	06/17/11	Zeljko	0
HIV attack	CLOSED	06/05/11	06/30/12	Overlord13	1
TEST	CLOSED	06/14/11	06/18/11	csac1959	2
Homology_Praktikum_IBK_SS11	CLOSED	06/16/11	06/20/11	csac1959	9
m,jb ghj	CLOSED	06/15/11	12/31/14	oxyi	0
m,jb ghj	CLOSED	06/15/11	12/31/14	oxyi	1
hnvfcfhncfh kbkkkh	CLOSED	06/15/11	12/31/14	oxyi	1
Freestyle Design - 80 (Anthropic Dreams team members)	CLOSED	06/17/11	06/22/11	Seagat2011	4
Freestyle Design - 20 (ST - Recipe Research Channel)	CLOSED	06/18/11	06/30/11	Seagat2011	1
Freestyle Design Competition	CLOSED	06/20/11	06/30/11	Dinoclor	1
any one can join too	CLOSED	06/26/11	09/01/11	plh	1
contest	CLOSED	06/26/11	07/13/11	madpenguin	2
vghubzysd rx	CLOSED	07/31/11	12/31/13	oxyi	1
anyone can join (actually)	CLOSED	07/05/11	12/16/11	madpenguin	0
Atoh1 Atonal homolog 1	CLOSED	07/11/11	08/01/11	RANimick	0
Laurabee's puzzle	CLOSED	07/13/11	07/14/11	laurabee	0
Test	CLOSED	07/15/11	07/01/12	berus	1
Test2	CLOSED	07/15/11	07/17/11	berus	1
Freebuild	CLOSED	07/18/11	07/20/11	e-wok456	1
Freestyle Competition	CLOSED	07/19/11	07/26/11	rattlesnake8	0
freebuild2	CLOSED	07/18/11	07/20/11	e-wok456	1
Alignment test	CLOSED	07/23/11	07/24/11	harvardman	0
Let's have fun.	CLOSED	07/25/11	08/02/11	etety33	1
Mr Ma No.1	CLOSED	07/27/11	07/31/12	mayumiao	1
To have fun	CLOSED	07/29/11	07/20/14	mayumiao	1
Mr Ma No. One	CLOSED	07/29/11	07/29/14	mayumiao	1
Random Puzzle	CLOSED	08/03/11	08/04/11	Mp0907	0
Random Puzzle	CLOSED	08/03/11	08/04/11	Mp0907	1
430	CLOSED	08/03/11	08/04/11	laurabee	1
PODXL	CLOSED	08/04/11	08/26/11	machoo	1
Rv0500B - small protein from Mycobacterium tuberculosis H37Rv	CLOSED	08/24/11	08/10/14	rws	92
A Freestyle Design 80 Open to all	CLOSED	08/14/11	09/30/12	itskimo	69
A Freestyle Design 40 Open to all	CLOSED	08/14/11	08/31/12	itskimo	68
A Freestyle Design 20 Open to all	CLOSED	08/14/11	08/31/12	itskimo	288
Freestyle Simple	CLOSED	08/19/11	08/21/14	WheelerLovett	0
Freestyle Simple	CLOSED	08/19/11	08/21/14	WheelerLovett	1
laura test	CLOSED	08/23/11	08/24/11	laurabee	1
laura test2	CLOSED	08/23/11	08/24/11	laurabee	1
Chem 431 contest	CLOSED	08/24/11	09/19/11	laurabee	28
Compbio	CLOSED	08/22/11	08/23/11	hahnbeom	5
Compbio2	CLOSED	08/22/11	08/23/11	hahnbeom	5
Compbio3	CLOSED	08/22/11	08/23/11	hahnbeom	5
Compbio4	CLOSED	08/22/11	08/23/11	hahnbeom	5
MediumFREE STYLE	CLOSED	08/23/11	08/31/14	WheelerLovett	0
MediumFREE STYLE	CLOSED	08/23/11	08/31/14	WheelerLovett	1
BIG CASP9 contest	CLOSED	08/23/11	02/01/12	wudoo	68
Rv0657c - small protein from Mycobacterium tuberculosis H37Rv	CLOSED	08/23/11	08/31/14	rws	61
LETSGO	CLOSED	08/26/11	08/27/11	wudoo	4
A HIV Protease open to all	CLOSED	08/27/11	09/30/12	itskimo	496
A GTPase Ras Open To All	CLOSED	08/27/11	09/30/12	itskimo	131
GTPase Ras	CLOSED	09/10/11	09/01/12	glenwayguy	1
VopX	CLOSED	09/20/11	10/20/11	rabidfurball	1
my contest	CLOSED	09/20/11	12/20/11	Lysergic cure	1
Freestyle	CLOSED	09/21/11	09/29/11	Stano28	0
Dengue Virus NS3 protease domain	CLOSED	09/26/11	10/31/11	Neffets	1
arabic group	CLOSED	09/22/11	09/22/14	ahmed magdy	1
GTPase Ras	CLOSED	09/23/11	10/07/11	Miah	2
aj	CLOSED	09/23/11	09/24/11	ilikeike	1
CURE CANCER win	CLOSED	09/24/11	09/25/12	Ross3	1
Facile for Italian :)	CLOSED	09/24/11	10/24/11	Vaio	1
Multi-histidine and Glutamate sequence complexed with Mn(II)	CLOSED	09/26/11	10/10/11	masspeana	1
BCHS 3201	CLOSED	09/26/11	11/30/11	Fotis NKS	0
BCHS 3201	CLOSED	09/26/11	11/30/11	Fotis NKS	0
j	CLOSED	09/30/11	10/01/11	klixovann	0
contest	CLOSED	09/27/11	12/25/11	meganium214	0
contest	CLOSED	09/27/11	12/25/11	meganium214	0
HIV protease new	CLOSED	09/29/11	10/31/11	davidpat	1
test00	CLOSED	09/29/11	09/30/11	spacevet	1
Michael and Marco	CLOSED	10/05/11	10/06/11	bigbanggd410	0
Michael and Marco	CLOSED	10/05/11	10/06/11	bigbanggd410	0
Michael and Marco	CLOSED	10/05/11	10/06/11	bigbanggd410	2
test071	CLOSED	10/07/11	10/09/11	b3au071	1
efeli	CLOSED	10/11/11	10/12/11	chatask	1
HIV challenge	CLOSED	10/09/11	10/30/11	ofc2000	0
ClpB	CLOSED	10/09/11	10/28/12	kevinjh	1
Short Blank	CLOSED	10/10/11	10/31/12	kevinjh	1
Sandbox	CLOSED	10/10/11	10/31/12	kevinjh	1
SAY HI TO ZACH	CLOSED	10/11/11	10/31/11	za-za22	0
test	CLOSED	10/12/11	10/13/11	laurenting	1
BMI 206 test contest - protease	CLOSED	10/12/11	10/13/11	amelie.stein	1
BMI 206 test contest - Ras	CLOSED	10/12/11	10/14/11	amelie.stein	1
Freestyle Design 500	CLOSED	10/16/11	11/06/11	ofc2000	1
HIV protease	CLOSED	10/17/11	10/22/11	Joshua Algode	1
UCSF Intro Puzzle	CLOSED	10/21/11	10/25/11	beta_helix	21
TR624	CLOSED	10/25/11	11/06/11	beta_helix	2
GTPase Ras	CLOSED	10/19/11	03/18/12	wangyueyun	1
hiv protease	CLOSED	10/19/11	10/19/12	jerrywhite13	1
casp training	CLOSED	10/20/11	10/31/11	vk1982	1
the contest	CLOSED	10/21/11	10/28/11	Mozzi	4
first contest	CLOSED	10/20/11	10/21/11	Robinso	1
UCSF DNA Challenge	CLOSED	10/25/11	11/06/11	beta_helix	3
Alignment tool (join link in desc)	CLOSED	10/26/11	12/31/11	riking	7
My first contest	CLOSED	10/26/11	10/31/11	awesome4132	1
ACP	CLOSED	10/27/11	10/12/12	mike r	0
ACP	CLOSED	10/27/11	10/12/12	mike r	1
ofc2000's tough challenge (open)	CLOSED	10/29/11	10/31/11	ofc2000	1
just do it	CLOSED	10/30/11	12/31/11	pokemon.guy	0
One day challenge	CLOSED	11/04/11	11/05/11	scienceschmoo	0
One day challenge	CLOSED	11/04/11	11/05/11	scienceschmoo	1
Dog tests himself	CLOSED	11/07/11	11/08/11	est000dog	1
JJJP bmi206 fold	CLOSED	11/07/11	11/30/11	Peter2000	0
PA1955_Repeat	CLOSED	11/10/11	12/23/11	MadsTS	1
Polish Contest	CLOSED	11/20/11	12/20/11	Mojzesz	4
SEAL MYOGLOBIN	CLOSED	11/23/11	01/31/12	Ch Garnier	14
hemoglobin check	CLOSED	11/26/11	11/30/11	Rellis	1
GTPase Ras	CLOSED	11/25/11	12/31/11	O Seki To	0
Seal Myoglobin	CLOSED	11/26/11	11/29/11	Lelivret	1
a	CLOSED	11/27/11	12/19/11	JimmyFraktal	1
asf	CLOSED	11/27/11	11/30/11	JimmyFraktal	0
Myoglobin	CLOSED	11/30/11	12/23/11	Ronald Wichman	0
Test_steveB	CLOSED	12/01/11	12/08/11	steveB	1
Governors Academy Freestylin'	CLOSED	12/02/11	12/04/11	conorodea111	1
jnkljnklhjnljnljnl	CLOSED	12/04/11	12/31/11	oxyi	0
jnkljnklhjnljnljnl	CLOSED	12/04/11	12/31/11	oxyi	1
Beginner Alignment Puzzle	CLOSED	12/06/11	12/31/11	kitek314_pl	1
A Computer Tester	CLOSED	12/09/11	12/08/12	mat747	2
Knotfind on	CLOSED	12/10/11	12/31/11	beta_helix	6
Cancer Puzzle	CLOSED	12/11/11	12/25/11	EzraThexton	1
Test Puzzle	CLOSED	12/18/11	12/19/11	kurenan	1
SERPINB5	CLOSED	12/19/11	12/26/11	Niubilism	0
BLARG	CLOSED	12/20/11	12/21/11	Chappers	0
BLARG	CLOSED	12/20/11	12/21/11	Chappers	2
Montcrest	CLOSED	12/20/11	01/31/12	Chappers	3
Montcrest for real	CLOSED	12/20/11	01/31/12	Chappers	1
Montcrest	CLOSED	12/20/11	01/31/12	Chappers	1
HIV	CLOSED	12/20/11	01/31/12	Chappers	7
hjjjjjjjjjjjjjjjjjj	CLOSED	12/20/11	12/31/14	oxyi	1
my freestyle trial	CLOSED	12/20/11	12/27/11	Niubilism	1
Small partial Tspan peptide	CLOSED	12/21/11	12/31/11	rwarn	1
variable freestlye design	CLOSED	12/21/11	12/31/11	sum	0
variable freestlye design	CLOSED	12/21/11	12/31/11	sum	1
Freestyle Design	CLOSED	12/24/11	12/31/11	r4m3nn00dl3s	0
jujujujujujujujujujujujujuj ujujujujujujujujujujujujujujujujujujujujujujuju	CLOSED	12/24/11	12/31/14	oxyi	1
Quick & Dirty KnotFind	CLOSED	12/25/11	01/03/12	Vincero	1
Spielwiese - HIV Protease	CLOSED	12/25/11	03/31/12	Bithalbierer	7
Spielwiese - Freestyle Design (Variable Length)	CLOSED	12/25/11	03/31/12	Bithalbierer	4
Test Protein	CLOSED	12/26/11	03/31/12	kurenan	1
vroom	CLOSED	01/02/12	01/28/12	kasmol	1
Can you foldit?	CLOSED	01/03/12	04/20/12	S-Man	0
CC	CLOSED	01/05/12	01/07/12	obson	0
test	CLOSED	01/12/12	01/31/12	gurimmer	0
test	CLOSED	01/12/12	01/31/12	gurimmer	1
phospholipase A2 from mamushi snake venom	CLOSED	01/11/12	01/26/12	gurimmer	0
Test test	CLOSED	01/06/12	01/13/12	smfuchs	1
Can you win?	CLOSED	01/06/12	01/07/12	thekidsglenn7	1
HIV	CLOSED	01/07/12	02/11/12	fallenspartan	1
prova	CLOSED	01/08/12	01/17/12	hu74go	1
Freedom	CLOSED	01/07/12	01/09/12	qbolt500	0
FANTASY	CLOSED	01/09/12	01/10/12	hu74go	1
begginer	CLOSED	01/10/12	01/19/12	bobbyjoejr	0
Freestyle!!!	CLOSED	01/11/12	01/12/12	adele21	0
seal myoglobin	CLOSED	01/13/12	01/31/12	sum	1
seal myoglobin	CLOSED	01/13/12	01/31/12	sum	0
HIV protease	CLOSED	01/16/12	01/17/12	recondite7	0
HIV protease	CLOSED	01/16/12	01/20/12	recondite7	2
Degradation of Wood! Lets understand methane and CO2 production!	CLOSED	01/21/12	09/30/12	losWEEDos	1
HIV Protease	CLOSED	01/21/12	03/03/12	recondite7	159
Hexaguin's Freestyle 80	CLOSED	01/22/12	01/31/12	hexaguin	1
myoglobin	CLOSED	01/22/12	01/26/12	vacmar	1
Bioc WSC	CLOSED	03/06/12	03/08/12	jcnichols	27
HIV protease	CLOSED	01/25/12	01/31/12	docfon	1
Bioc_670_2	CLOSED	01/26/12	02/10/12	bkuhlman	1
bioc_3	CLOSED	01/26/12	02/14/12	bkuhlman	18
Bioc_670_Protease	CLOSED	01/26/12	02/10/12	bkuhlman	1
Just For Fun	CLOSED	01/26/12	01/27/12	Metadryad	1
Some Test Contest	CLOSED	01/26/12	02/05/12	Biology-EtcManager	2
Random	CLOSED	01/28/12	01/31/12	dabanks	1
Trying something out :) pardon	CLOSED	01/31/12	02/29/12	PeptideMuncher	1
Theoredoxin	CLOSED	01/31/12	01/31/14	PeptideMuncher	1
Testdudetest	CLOSED	01/31/12	02/29/12	testdudetest	1
CRAC	CLOSED	01/31/12	02/23/12	testdudetest	1
Freestyle Design 80	CLOSED	01/31/12	02/09/12	kimdn	1
test-contest	CLOSED	02/01/12	02/02/12	climax141	1
chemchem111	CLOSED	02/01/12	02/02/12	nlite510	1
Moloney Murine Leukaemia Virus Matrix Protein	CLOSED	02/01/12	02/03/12	beta_helix	4
H3 Hemagglutinin Flu Design Puzzle	CLOSED	02/01/12	02/03/12	beta_helix	4
leukaemia virus chain native matrix	CLOSED	02/01/12	08/27/12	GoshaDole	1
bioc_670_design	CLOSED	02/01/12	02/15/12	bkuhlman	19
Holotoxin	CLOSED	02/03/12	02/06/12	Erik.dover	0
Biology-NanogContest	CLOSED	02/03/12	02/29/12	Seth Cooper	99
Sandbox1	CLOSED	02/03/12	02/29/12	nlite510	1
Sim-based Lifecycle Engineering	CLOSED	02/29/12	03/31/12	mxynidis	1
Bio 152EC	CLOSED	02/06/12	02/16/12	smfuchs	1
Freestyle Design: Variable Length	CLOSED	05/02/13	05/10/13	ligandfinder	1
Adelphi FHB Design	CLOSED	05/02/13	05/12/13	ligandfinder	6
BIo152 EC	CLOSED	02/07/12	02/16/12	smfuchs	1
erero7 challenge	CLOSED	02/08/12	02/29/12	erero7	0
erero7 challenge	CLOSED	02/08/12	02/29/12	erero7	0
erero7 challenge	CLOSED	02/08/12	02/29/12	erero7	0
erero7 challenge	CLOSED	02/08/12	02/29/12	erero7	1
Test Puzzle to Fix Client	CLOSED	02/08/12	02/29/12	beta_helix	23
design your own protein	CLOSED	02/13/12	02/14/14	mberna00	1
more thunk testing	CLOSED	03/29/12	06/30/12	anthunk	9
Moloney Murine Leukaemia Virus Matrix Protein	CLOSED	02/14/12	05/15/12	Ch Garnier	29
khfchlk 1	CLOSED	02/23/12	02/24/12	Solenopsis invicta	1
CLEAN ME!!!!!!!!!!!!!!!!!	CLOSED	02/17/12	02/18/12	Bjamin	1
cyrusi's challange	CLOSED	02/17/12	01/01/15	cyrusi	0
hi	CLOSED	02/17/12	02/29/12	cyrusi	1
Halorhodopsin	CLOSED	02/18/12	02/26/12	MnSOD	0
hi2	CLOSED	02/18/12	03/01/12	cyrusi	1
CASP Training	CLOSED	02/18/12	04/30/12	nealk	1
C21ECL	CLOSED	02/21/12	02/25/12	lijiahua1984	1
C21ECL-1	CLOSED	02/21/12	02/24/12	lijiahua1984	1
love vs. love	CLOSED	02/22/12	02/24/12	k.love	2
Test contest	CLOSED	02/23/12	02/23/13	f1pokerspeed	1
vroom2	CLOSED	02/24/12	03/24/12	kasmol	2
Test2	CLOSED	02/23/12	02/23/13	9ct29	1
GTPase Ras test	CLOSED	02/29/12	04/30/12	oshirikajirimushi18th	1
HIV protease test	CLOSED	03/01/12	05/01/12	oshirikajirimushi18th	1
Tspan peptide 2	CLOSED	03/03/12	04/01/12	rwarn	1
HIV Protease	CLOSED	03/05/12	03/01/13	dbuske	1
Bioc WSC EC	CLOSED	03/06/12	03/07/12	jcnichols	1
Nanog Homeobox Protein (NANOG)	CLOSED	03/07/12	03/07/13	Ch Garnier	34
Monooxygenase	CLOSED	03/10/12	04/30/12	hansfoldit	0
test	CLOSED	03/11/12	03/12/12	RedVenom	1
Yu's lab C2E1	CLOSED	03/11/12	03/01/15	lijiahua1984	1
Just playing around	CLOSED	03/13/12	03/20/12	wdherndon	1
test	CLOSED	03/13/12	03/20/12	mk18	1
For my students	CLOSED	03/16/12	03/23/12	GirichMS	1
blabla	CLOSED	03/17/12	03/24/12	ccilia	1
Freestyle 20	CLOSED	03/17/12	03/20/12	upquark	1
For students	CLOSED	03/18/12	04/30/12	GirichMS	1
For stud. 2	CLOSED	03/18/12	04/30/12	GirichMS	1
For stud. 3	CLOSED	03/18/12	04/30/12	GirichMS	1
This freestyle puzzle	CLOSED	03/18/12	04/30/12	GirichMS	1
No. 4.	CLOSED	03/18/12	04/30/12	GirichMS	1
No. 5	CLOSED	03/18/12	04/30/12	GirichMS	1
No. 6	CLOSED	03/18/12	04/30/12	GirichMS	1
ligan practice -open to all	CLOSED	03/21/12	03/31/12	Mike Tate	3
Mat test	CLOSED	03/20/12	03/20/13	mat747	1
Bioc WSC EC	CLOSED	03/25/12	03/31/12	jcnichols	27
first time	CLOSED	03/24/12	03/25/12	billyhuegel	1
good luck	CLOSED	03/24/12	03/25/12	billyhuegel	1
dont worry	CLOSED	03/24/12	03/29/12	billyhuegel	0
Cancer Treatment Contest	CLOSED	03/24/12	04/24/12	DaVinci21	1
Freestyle Design 80	CLOSED	03/24/12	09/30/12	ofc2000	1
artificial muscle	CLOSED	03/25/12	03/31/12	AkimotoYuki	0
Lastest contest against the cancer	CLOSED	03/30/12	12/31/15	Dj-P	105
clamp test	CLOSED	03/30/12	03/31/12	hilaryar	1
Cameron	CLOSED	04/03/12	04/04/12	Cameron Baxendale	0
Cameron	CLOSED	04/03/12	04/04/12	Cameron Baxendale	1
TFS dwewf	CLOSED	04/03/12	04/04/12	jperoff	2
Acyl Hydrolase	CLOSED	04/03/12	04/04/12	MichaelGasse	1
Foamy Virus Gag protein	CLOSED	04/10/12	04/17/12	blutjoghurt	1
BioClass	CLOSED	04/11/12	04/15/12	sarahod23	1
Human Respiratory Syncytial Virus Attachment Protein (RSV G)	CLOSED	04/12/12	07/31/12	MiCu	1
HIV test	CLOSED	04/11/12	04/13/12	SciShowFTW	1
(Closed) PEP Private Contest II	CLOSED	04/12/12	04/18/12	prolylendopeptidase	4
(Closed) PEP Private Contest III	CLOSED	05/22/12	05/31/12	prolylendopeptidase	3
Go freestyle!	CLOSED	04/15/12	04/22/12	AsDawnBreaks	1
Test	CLOSED	04/21/12	06/14/13	paulsen	0
Freestyle Design 500	CLOSED	04/16/12	04/29/12	drumpeter18yrs9yrs	2
test	CLOSED	04/16/12	04/22/12	test_account1	41
PFV Gag	CLOSED	04/17/12	07/17/12	blutjoghurt	1
BHS - Nanog Contest	CLOSED	04/24/12	05/12/12	katievh	125
Dana_Nicolo	CLOSED	04/17/12	04/18/12	dananumber13	3
DcmB	CLOSED	04/18/12	07/13/12	shadowwalk	0
Long links	CLOSED	04/21/12	04/30/12	AsDawnBreaks	6
Freestyle Design	CLOSED	04/22/12	04/30/14	michaeldee	1
40 Segment Chain	CLOSED	04/22/12	04/30/14	michaeldee	1
contest	CLOSED	04/22/12	04/24/12	yesir	2
Protein Contest	CLOSED	04/25/12	12/31/12	Dave Levine	0
Tiroler Nacht der Forschung	CLOSED	04/25/12	04/29/12	obiwan	1
Tiroler Nacht der Forschung 2	CLOSED	04/25/12	04/29/12	obiwan	1
Let's go!!!!	CLOSED	04/28/12	12/12/12	wendy_rupnow	0
Let's go!!!!	CLOSED	04/28/12	12/12/12	wendy_rupnow	0
Blarghs contest	CLOSED	04/30/12	12/31/12	blargh123	1
LPDF Contest	CLOSED	04/30/12	05/03/12	maxionwimps	1
[DEPRECATED] GTPase Ras long run Anyone can join!	CLOSED	01/28/14	12/31/15	AsDawnBreaks	128
GOVST BIOCHEMISTRY	CLOSED	05/07/12	12/17/12	govstbiochem	1
sample	CLOSED	05/08/12	05/22/12	govstbiochem	0
rc013	CLOSED	05/09/12	05/31/12	jlmaccal	1
HIV stinks.... yeah yeah	CLOSED	05/12/12	05/01/14	tweak64	1
contest de foldit	CLOSED	05/15/12	05/18/12	Alakazam Einstein	2
80 and everyone	CLOSED	05/15/12	12/31/12	Alakazam Einstein	73
Marcus	CLOSED	05/17/12	05/20/12	mdaquino	1
test test	CLOSED	05/19/12	05/20/12	Stolaf	1
Ael	CLOSED	05/20/12	06/03/12	Aralys	1
Knots	CLOSED	05/22/12	05/23/12	AsDawnBreaks	1
Common Immunogenic Substrate (Fragment)	CLOSED	05/23/12	06/30/12	scooper14	3
33mer From Shan et. al.	CLOSED	05/23/12	06/30/12	scooper14	2
13-mer toxic peptides	CLOSED	05/23/12	05/31/12	hanhnguyen14	1
SEAL MYOGLOBIN	CLOSED	05/25/12	11/25/12	Ch Garnier	19
Serine Proline Rich AfCNA	CLOSED	05/25/12	06/28/12	cookie2004	1
DSSP algorithm vs NR data base	CLOSED	05/29/12	06/29/12	BitSpawn	6
Wolfer's Class	CLOSED	05/31/12	06/06/12	NTWII	4
Wolfer's Class 2	CLOSED	05/31/12	06/06/12	NTWII	1
Test field 1	CLOSED	06/01/12	06/02/12	phi16	1
No Peeking - Immediately drag puzzle off screen when beginning. Players should NEVER see the protein.	CLOSED	06/01/12	06/30/12	phi16	46
tester	CLOSED	06/01/12	06/02/12	CharlieFortsConscience	2
Transmembrane Molecule Modelling	CLOSED	06/01/12	06/30/12	Beerwing	1
Testing puzzle	CLOSED	06/03/12	10/03/12	Ch Garnier	6
SAC Summer 2012 OChem Challenge	CLOSED	06/04/12	06/10/12	brian.parker	24
N-GlnR	CLOSED	06/09/12	09/30/12	weihuachen5211	1
Homology Modeling Course: HIV Protease	CLOSED	06/12/12	06/15/12	obiwan	7
SarNorA	CLOSED	06/12/12	07/12/12	docsaro	1
Test Protein	CLOSED	06/12/12	06/12/13	kurenan	1
Kumamolisin	CLOSED	06/13/12	07/31/15	drummerdude204	1
Trm7	CLOSED	06/14/12	06/21/12	v0lfg0ng	1
Test	CLOSED	06/15/12	06/16/12	xDust	0
Design Space	CLOSED	06/15/12	06/21/14	drummerdude204	80
Design it	CLOSED	06/15/12	06/21/14	DustWitch	1
CASP9 Target 611 residue protein	CLOSED	06/18/12	06/18/13	meatexplosion	2
Freestyle Design 40: For Learning LUA	CLOSED	06/24/12	06/30/15	gitwut.lua	1
Everyone Join!	CLOSED	06/28/12	12/24/13	lakeyja900	130
coolkids2 contest	CLOSED	07/06/12	07/07/12	meelock	1
coolkids2 contest	CLOSED	07/06/12	07/07/12	meelock	0
the testing puzzle!	CLOSED	07/09/12	08/31/12	drumpeter18yrs9yrs	0
HIV protease	CLOSED	07/09/12	07/31/12	drumpeter18yrs9yrs	0
Toxic Gluten Molecule	CLOSED	07/11/12	07/29/12	scooper14	6
Toxic Gluten Peptide	CLOSED	07/11/12	07/29/12	scooper14	6
Just 4 fun	CLOSED	07/12/12	07/20/12	Josephdud66	1
intracellular Caspase-Modulating Chimeric Antigen Receptor	CLOSED	07/17/12	07/17/14	starone	0
Yes	CLOSED	07/24/12	07/25/12	JBrown2322	2
Sugar Binding Puzzle	CLOSED	07/24/12	07/30/12	beta_helix	6
biocon	CLOSED	07/26/12	07/27/12	aurabum	1
Contest	CLOSED	07/30/12	07/31/12	Nicbudd77	0
test asdfg	CLOSED	07/31/12	08/02/12	Asbiorn	0
extended_design_tj	CLOSED	08/02/12	08/05/12	TJBrunette	1
A london Olympic contest!	CLOSED	08/05/12	08/12/12	junh821	4
Beginner HIV protease	CLOSED	08/07/12	08/10/12	rarkenin	1
SHELL	CLOSED	08/09/12	08/08/13	chingsong	0
test	CLOSED	08/09/12	08/09/13	chingsong	0
Big Win	CLOSED	08/14/12	12/31/15	alexlan	0
Freestyle	CLOSED	08/16/12	08/30/12	Mytherus	1
500 residue freestyle!	CLOSED	08/16/12	08/20/14	meatexplosion	3
Beat it!	CLOSED	08/17/12	08/18/12	Quinton830	0
d o	CLOSED	08/23/12	08/23/15	Joanna Staite	0
zhustb	CLOSED	08/26/12	08/25/13	chingsong	1
Varriable Freestyle	CLOSED	08/30/12	09/30/12	Dishrat006	0
virus	CLOSED	09/02/12	12/28/12	Aqua817	1
Just for test	CLOSED	09/06/12	09/07/12	dyh	1
the protein	CLOSED	09/07/12	09/26/15	river12345	1
working in a mutate script	CLOSED	09/07/12	09/01/13	BitSpawn	1
Open 500 Segment design puzzle	CLOSED	09/09/12	12/31/15	Ryanfav	49
My first contest	CLOSED	09/14/12	09/30/12	SOARcdur	1
GTPase pas puzzle	CLOSED	09/14/12	12/31/12	SOARcdur	1
you betta win	CLOSED	09/19/12	09/23/12	SOARcmoo	1
все надоемо	CLOSED	09/24/12	09/30/12	egik1997	1
l2pmike	CLOSED	09/24/12	09/25/12	OppaProteinStyleZ	0
l2pmike	CLOSED	09/24/12	09/25/12	OppaProteinStyleZ	0
freestyle fun	CLOSED	09/26/12	12/31/12	saggyballs	1
Clayton Biochemistry Fall 12	CLOSED	09/30/12	12/01/12	rsingiser	17
40 aa class test	CLOSED	09/27/12	12/01/12	rsingiser	1
Entamoeba insertion domain	CLOSED	10/06/12	10/12/13	lucnoken	1
Rod	CLOSED	10/08/12	10/09/12	Rodrigo999	0
Rodrigo	CLOSED	10/08/12	10/16/15	Rodrigo999	1
Freestyle	CLOSED	10/08/12	10/07/13	asdf9	8
Flu Puzzle Competition	CLOSED	10/09/12	10/11/12	beta_helix	28
Cancer Puzzle	CLOSED	10/09/12	10/11/12	beta_helix	1
Malaria Puzzle	CLOSED	10/09/12	10/11/12	beta_helix	3
Flu Puzzle	CLOSED	10/09/12	10/11/12	beta_helix	3
Bioc F12 EC#1	CLOSED	10/11/12	10/15/12	jcnichols	30
Freestyle design 40	CLOSED	10/09/12	10/09/14	meatexplosion	1
Freestyle design 20	CLOSED	10/09/12	10/09/14	meatexplosion	1
test for M-SBVfCT	CLOSED	10/12/12	10/13/12	tjbertram	0
test of SmfT0743fCT	CLOSED	10/12/12	10/13/12	tjbertram	0
Trichoplusia ni. Gloverin Protein	CLOSED	10/12/12	12/31/13	ainstein001	1
Multi-Start Bacteroides Vulgatus Contest	CLOSED	10/13/12	04/13/13	Ch Garnier	17
Server models for T0743 Contest	CLOSED	10/13/12	05/13/13	Ch Garnier	12
Penn State Hershey BMS 504	CLOSED	10/15/12	10/28/12	iropson	1
Penn State Hershey BMS 504 Contest 2	CLOSED	10/15/12	10/28/12	iropson	27
Bioc EC #2	CLOSED	10/16/12	10/17/12	jcnichols	18
Frizzled Design Puzzle Contest - October PD	CLOSED	10/25/12	11/01/12	katievh	1
Kenny	CLOSED	10/26/12	01/01/13	kennyhill	0
freestyle test	CLOSED	10/27/12	10/28/12	Marek_Berlin	1
Metallothionein	CLOSED	11/05/12	11/30/12	Phil.Pa	1
Test Scripting - ZKora	CLOSED	11/08/12	11/30/12	ZKora	1
Albert	CLOSED	11/13/12	11/14/12	Albert_tanjaya	2
AP Bio Puzzle 1	CLOSED	11/15/12	11/18/12	APTeach235	1
design	CLOSED	11/22/12	12/31/13	smart guy	0
Design 40	CLOSED	11/17/12	12/17/12	clptrsn	1
FUN! FUN!	CLOSED	11/17/12	11/30/15	alexkarate	0
Freestyle Design 500	CLOSED	11/21/12	11/22/12	Daileyc	0
hahhaaha cool.	CLOSED	11/19/12	11/23/12	joshlitchman	1
marolidas sandbox	CLOSED	11/20/12	11/27/12	marolidas	1
fire and rain	CLOSED	11/20/12	12/22/12	mattymoe	1
fire and rain	CLOSED	11/20/12	12/22/12	mattymoe	1
Black Nest of doom	CLOSED	11/23/12	12/31/12	mattymoe	0
Black Nest of doom	CLOSED	11/23/12	12/31/12	mattymoe	1
Black Nest of Doom	CLOSED	11/23/12	12/31/12	mattymoe	2
GTPase Ras	CLOSED	11/23/12	12/28/12	ridesisapis	0
Script testing	CLOSED	11/23/12	12/31/15	Jean-Bob	11
fold it contest	CLOSED	11/29/12	11/30/12	ylecroy	2
Frizzle	CLOSED	12/02/12	03/02/13	marie_s	1
Streptococcus pneumoniae	CLOSED	12/02/12	12/31/12	Placebo	1
Streptococcus pneumoniae 80	CLOSED	12/02/12	12/31/12	Placebo	1
>R0023 SP18154A, Streptococcus pneumoniae, 100 residues MRAQSFFLTFSFIRSKIKLALNKGVLNMIEITYIDASKNERTVTFESYEDFERSQQACLI GVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN	CLOSED	12/02/12	12/10/12	margo311	1
lms friends	CLOSED	12/03/12	12/04/12	johncb3	0
Monkeys Rock Ham jhhh hhhhhhhhh	CLOSED	12/04/12	12/30/12	NathanGotSkills23	0
Everyone can join	CLOSED	12/03/12	01/16/13	junikl2	1
HIV	CLOSED	12/05/12	12/29/12	Quxwozing	1
cancer help	CLOSED	12/06/12	12/31/13	jordansapp1	2
Test 123	CLOSED	12/07/12	12/14/12	RicGray	1
Spielwiese Freestyle Design 40	CLOSED	12/08/12	12/31/13	Bithalbierer	1
bioinformatic task for exam	CLOSED	12/09/12	12/20/12	margo311	0
bioinformatic task for exam	CLOSED	12/09/12	12/20/12	margo311	0
bioinformatic task for exam	CLOSED	12/09/12	12/20/12	margo311	1
100 amino acids	CLOSED	12/09/12	12/20/12	margo311	0
100 amino acids	CLOSED	12/09/12	12/20/12	margo311	1
>R0023 SP18154A, Streptococcus pneumoniae, 100 residues	CLOSED	12/09/12	12/25/12	margo311	1
Second part	CLOSED	12/10/12	12/24/12	Placebo	1
Easy Contest	CLOSED	12/12/12	12/30/12	haywick	0
Bio152	CLOSED	12/13/12	01/31/13	smfuchs	1
Fastest person	CLOSED	12/13/12	12/22/12	ponies_rock	1
DR.B JWU BIOCHEM	CLOSED	12/19/12	02/10/13	drmbudziszek	0
FTN1438	CLOSED	12/19/12	12/31/13	nwabu1ao	1
11	CLOSED	12/20/12	01/29/13	ScottNDean	1
Membrane receptor	CLOSED	12/20/12	02/28/13	ScottNDean	1
Other receptor	CLOSED	12/20/12	12/14/13	ScottNDean	1
go with the flow	CLOSED	12/23/12	12/30/12	Npereira	1
Go with the flow 2	CLOSED	12/23/12	12/30/12	Npereira	1
Stop The HIV Protease	CLOSED	12/28/12	12/31/12	Evaesion	1
evaesion	CLOSED	12/28/12	12/31/12	Evaesion	0
Anyone can join, HIV Protease, OPEN TO ALL	CLOSED	01/06/13	02/10/13	Phillipthegreat	34
ww domain	CLOSED	01/08/13	01/31/13	deans	2
DR.B JWU BIOCHEM Contest-HIV protease	CLOSED	01/08/13	02/17/13	drmbudziszek	7
Testing Group Contests	CLOSED	01/09/13	01/10/13	auntdeen	0
Freestyle Design (80 segments)	CLOSED	01/13/13	01/31/14	OrigamiMaster	1
Testing Puzzle	CLOSED	01/15/13	01/31/13	thoyt2012	1
HIV protease - BIOL225	CLOSED	01/16/14	01/22/14	Kimbostu	6
Mad hatter	CLOSED	01/17/13	01/18/13	EmperorSupreme	0
feqf	CLOSED	01/21/13	01/17/15	jinguluninja	1
Tau Protein (441 residue htau40)	CLOSED	01/23/13	12/31/16	jinguluninja	1
test	CLOSED	01/24/13	01/01/14	sonneys	1
Frizzled Design because we are bored	CLOSED	01/24/13	01/27/13	jamiexq	17
Two Day Beat Back the Boredom Puzzle	CLOSED	01/24/13	01/26/13	auntdeen	14
Another Beat Back the Boredom Old Style	CLOSED	01/24/13	01/26/13	auntdeen	19
3 day speed folding	CLOSED	01/24/13	01/27/13	jamiexq	15
ferer gerge	CLOSED	01/27/13	01/13/16	jinguluninja	1
80 segment freestyle design. 1 month.	CLOSED	01/29/13	02/28/13	MurloW	10
THE OCTAGON v2	CLOSED	02/07/13	02/08/13	nomatic	1
LASA Octagon	CLOSED	02/07/13	02/10/13	JosephOleniczak	0
gtpase ras	CLOSED	02/09/13	02/01/15	jjwinkle4740	1
Drosophila Melanogaster nmd protein AAA superfamily	CLOSED	02/09/13	02/08/14	jjwinkle4740	1
nmd AAA ATPase	CLOSED	02/09/13	02/08/14	jjwinkle4740	9
Educurious Frizzled Design Puzzle Contest!	CLOSED	02/10/13	03/31/13	katievh	51
vgsetgethgtr rgwethg	CLOSED	02/14/13	02/14/16	oxyi	1
scritterTest	CLOSED	02/15/13	02/28/13	scritter	1
scritterTest2	CLOSED	02/15/13	02/28/13	scritter	1
Bio chem assignment	CLOSED	02/16/13	02/15/14	sonneys	0
biochem assignment	CLOSED	02/16/13	02/15/14	sonneys	1
WSU Bioc (S13)	CLOSED	02/18/13	02/20/13	jcnichols	37
Chicken Noodle Soup	CLOSED	02/17/13	06/22/13	mattymoe	1
Tbf1	CLOSED	02/20/13	07/17/13	Rivsie	1
BCHS3201	CLOSED	02/20/13	02/25/13	fahdkabani	3
fahdkabani	CLOSED	02/20/13	02/21/13	fahdkabani	2
Clayton Biochemistry Spring 13	CLOSED	02/25/13	05/05/13	rsingiser	25
Freestyle Variable Length. 1 month.	CLOSED	02/26/13	03/25/13	MurloW	8
Bioc S13 2nd chance	CLOSED	02/26/13	02/28/13	jcnichols	1
Bioc 2nd chance (S13)	CLOSED	02/28/13	03/02/13	jcnichols	3
HansDampf	CLOSED	02/28/13	05/03/13	Wilm	0
EL3 #2	CLOSED	03/01/13	05/03/13	Wilm	0
thing	CLOSED	03/03/13	03/04/13	erek	1
pechi demo	CLOSED	03/03/13	06/07/13	anthunk	2
Biokemi contest	CLOSED	03/05/13	03/06/13	MagnusA	1
HIV protease	CLOSED	03/05/13	03/26/13	alex809010	0
Elijahs contest	CLOSED	03/08/13	03/31/13	ilikediamonds	2
Test	CLOSED	03/09/13	07/20/13	mind_hack	1
HBV core protein	CLOSED	03/14/13	03/15/13	Tsogo	0
HBV core protein	CLOSED	03/14/13	03/23/13	Tsogo	1
A Battle in Design	CLOSED	03/14/13	03/14/14	TheEnderCavalier	0
Contest	CLOSED	03/16/13	03/31/13	dallinac	0
Contest	CLOSED	03/17/13	03/18/13	CardsOverCoins	1
ISHMIT DAHAL	CLOSED	03/18/13	03/19/13	USER2013	1
ricgtest	CLOSED	03/18/13	03/24/13	RicGray	0
UCDS Test Contest	CLOSED	03/25/13	04/30/13	UCDS_Test	3
For testing purposes	CLOSED	03/19/13	03/31/13	f00barbob	1
a test of rich disordered seq	CLOSED	03/19/13	03/31/13	wangxinyu_cn	1
The Fountain of Youth	CLOSED	03/20/13	03/31/16	deinfrank	0
Frizzled	CLOSED	03/21/13	03/23/13	beta_helix	1
40 segment Freestyle Design. 2 weeks.	CLOSED	03/22/13	04/06/13	MurloW	3
SMIM1	CLOSED	03/24/13	03/31/13	gestur	3
3G	CLOSED	03/25/13	04/30/13	rvalensia	1
Test 2	CLOSED	03/25/13	04/30/13	RicGray	0
Moar Freestyle Design. 80 seg, 1 week	CLOSED	03/26/13	04/02/13	MurloW	2
Super Freestyle	CLOSED	03/27/13	04/27/13	super_Nethergirl	1
Super Freestyle	CLOSED	03/27/13	04/27/13	super_Nethergirl	1
Biotech WFB 1	CLOSED	03/28/13	04/09/13	KBrown	2
Biotech WFB HIV	CLOSED	03/28/13	04/09/13	KBrown	0
UCDS April Contest	CLOSED	04/01/13	04/30/13	UCDS_A0	24
hmm	CLOSED	04/07/13	04/09/13	MurloW	1
Wisks Contest	CLOSED	04/06/13	04/30/13	WiskIRC	2
hm	CLOSED	04/07/13	04/09/13	MurloW	1
Freestyle Design Variable Length. 2 weeks	CLOSED	04/09/13	04/24/13	MurloW	1
Multi-domain protein	CLOSED	04/10/13	07/10/13	pbartlow	1
First molecule	CLOSED	04/12/13	04/13/13	gsandoval	1
Freestyle Design 80	CLOSED	04/13/13	04/20/13	JamesLeCornu	0
Freestyle 80 segment de-novo	CLOSED	04/22/13	04/27/13	wosser1	1
Vandeweyer_Protein	CLOSED	04/22/13	04/30/13	gvandeweyer	1
5cDraw Gutstopen	CLOSED	04/22/13	04/27/13	ManVsYard	1
P22-N	CLOSED	04/23/13	04/27/13	syoifczeri	1
P22-N^W[Tb]	CLOSED	04/23/13	04/30/13	syoifczeri	1
the great vacation raceoff	CLOSED	06/01/13	09/30/13	shadow345	0
Join if u Dare	CLOSED	04/26/13	04/20/14	srgp2012	5
2 weeks, 80 segment design.	CLOSED	04/27/13	05/11/13	MurloW	4
Freestyle Design 80	CLOSED	05/03/13	05/18/13	iqbalmahmud	1
Small Hepatitis B Surface Antigen (HBsAg)	CLOSED	05/07/13	05/07/14	bigben446	1
Test	CLOSED	05/12/13	05/17/13	MurloW	1
testing own script	CLOSED	05/13/13	12/31/16	Morus	1
Family and Friends	CLOSED	05/13/13	05/07/16	LunarEclipse	1
GTPase Ras	CLOSED	05/15/13	05/31/13	Ninty9	0
The Final Model	CLOSED	05/15/13	05/16/13	WheeDhee	8
ricg contest	CLOSED	05/17/13	05/18/13	RicGray	1
peptide test	CLOSED	05/31/13	05/17/14	syoifczeri	1
LOX enzyme from human	CLOSED	05/21/13	12/24/13	magnus groes	1
Reinhardt Demo stuff	CLOSED	06/04/13	06/18/13	ReinhardtScience	1
ScienceTeacherTresting	CLOSED	06/04/13	06/18/13	ReinhardtScience	0
scienceteach test wee	CLOSED	06/04/13	06/18/13	ReinhardtScience	1
FOlditExpo	CLOSED	06/06/13	06/11/13	ReinhardtScience1	1
CASPtraining	CLOSED	06/10/13	06/30/13	Linux_Penguin	0
protein desgin	CLOSED	06/11/13	06/14/13	ctdevlin	1
59 chain protein	CLOSED	06/12/13	06/30/13	ctdevlin	1
Start of Sumer HIV	CLOSED	06/19/13	06/26/13	nerdysib	1
GTPase Ras	CLOSED	06/19/13	07/20/13	ChinaSESsolve	1
PitA	CLOSED	07/16/13	08/10/13	canthony9	1
Sorry, This is test	CLOSED	06/27/13	06/28/13	myputer	1
prueba mioglobina	CLOSED	06/30/13	06/11/14	cmendo	1
Just a puzzle	CLOSED	07/01/13	07/31/13	wisky	1
Clayton Biochemistry Summer 13	CLOSED	07/03/13	07/24/13	rsingiser	15
test	CLOSED	07/04/13	07/05/13	Raphsup	4
Sup'BioFold	CLOSED	07/04/13	07/05/13	Darksliver	4
e235wef	CLOSED	07/07/13	07/23/16	phallicies	1
Highest score	CLOSED	07/07/13	12/25/13	dbuske	0
sup	CLOSED	07/09/13	07/10/13	bionano1	0
YneM	CLOSED	07/10/13	08/17/13	canthony9	1
De-Extinction!	CLOSED	07/10/13	07/31/13	gordon_wade	0
Acad Alignment Puzle	CLOSED	07/11/13	07/11/14	thomasjs223	1
Freestyle Design 40	CLOSED	07/12/13	07/12/16	Sadler	1
Beginner Alignment Puzzle Sup'Biotech	CLOSED	07/12/13	07/13/13	Darksliver	3
Freestyle Design 20	CLOSED	07/12/13	07/12/16	Sadler	1
UNC SHARP Contest 1	CLOSED	07/12/13	07/31/13	jetaiken	3
UNC SHARP Contest 2	CLOSED	07/12/13	07/31/13	Sharp3	0
UNC SHARP Contest 2	CLOSED	07/12/13	07/31/13	jetaiken	1
Virus Matrix	CLOSED	07/15/13	08/15/13	dbuske	1
Test	CLOSED	07/28/13	07/31/13	violinist67	0
PfTLP	CLOSED	07/16/13	07/16/14	BNGSTE001	1
Curing_Mad_Diseases_Bro	CLOSED	07/17/13	09/01/13	Cyren_Guerrero	1
testcol4a3bp	CLOSED	07/18/13	12/19/13	G_H_B	0
testcol4a3bp2	CLOSED	07/18/13	12/19/13	G_H_B	1
Adam & Tyler	CLOSED	07/20/13	07/23/13	Adamdejesus	1
Adam & Tyler	CLOSED	07/20/13	07/23/13	Adamdejesus	2
indoor soccer shoes adidas f50	CLOSED	07/24/13	07/26/13	Clarisonic123	0
Free test	CLOSED	07/29/13	08/23/13	eatfears	1
how to make unknownyytw	CLOSED	07/29/13	07/31/13	chinatsu	1
i-motif DNA structure	CLOSED	08/01/13	08/31/13	csjonline	0
Debugger	CLOSED	08/05/13	08/11/13	Tadasu	1
Science aids	CLOSED	08/09/13	08/12/13	sience geek	2
test	CLOSED	08/19/13	08/21/13	bkoep	1
design test	CLOSED	08/19/13	08/21/13	bkoep	1
Frizztest	CLOSED	08/20/13	08/31/13	spmm	1
Pace Academy 2014 HIV protease	CLOSED	08/21/13	12/21/13	thattori	37
Investigate Inspect Test	CLOSED	08/20/13	08/21/13	NickyCGS	3
200 Residue Freestyle!	CLOSED	08/21/13	08/21/14	meatexplosion	44
Small Dimer	CLOSED	08/22/13	08/29/13	spdenne	1
Solve for Treatment	CLOSED	08/30/13	09/10/13	PirateX12	2
SK SK	CLOSED	09/01/13	12/31/16	ScratchKid	1
SK SK	CLOSED	09/01/13	12/31/16	ScratchKid	2
1 week Freestyle 80seg Trimer Design	CLOSED	08/30/13	09/06/13	MurloW	2
HIV Protease	CLOSED	09/01/13	09/28/13	Gamerrr111	0
Spider silk design	CLOSED	09/01/13	12/31/16	Jirachi	1
test dimer	CLOSED	09/03/13	09/06/13	jsorr	1
Aptamers 1	CLOSED	09/04/13	12/31/13	Aiursfallen	1
BIIN351_1	CLOSED	09/04/13	09/18/13	ash	2
McCallie AP Biology	CLOSED	09/07/13	09/11/13	mccallieapbiology	0
HIV	CLOSED	09/15/13	09/29/13	trueplayer	0
NEAR contest	CLOSED	09/27/13	09/29/13	nyla12	1
battle royal	CLOSED	09/17/13	09/19/13	delay	0
Small test protein	CLOSED	09/17/13	12/31/13	wudoo	1
Small test protein 2	CLOSED	09/17/13	12/31/13	wudoo	1
yahya	CLOSED	09/17/13	01/13/16	yahyamohammed	0
Test your PC power	CLOSED	12/03/13	09/30/16	Bruno Kestemont	59
silk protein	CLOSED	09/22/13	09/13/14	danielgcc	1
HIV	CLOSED	09/26/13	09/24/16	ScoobyHusky	1
ella introduction	CLOSED	09/28/13	10/28/13	manasa	0
ELAV4_48_118	CLOSED	09/28/13	09/01/14	Panoramix	1
zekrom	CLOSED	09/30/13	01/01/14	canadajan	0
dan shit	CLOSED	10/05/13	10/06/13	nosleevesforlife	0
hiv positive	CLOSED	10/03/13	10/04/13	Mhembrough	1
Triple Helix DNA	CLOSED	10/03/13	10/31/15	Tovi	1
Sandbox	CLOSED	10/05/13	10/19/13	creteen	1
Trying to make a Propeller!	CLOSED	10/08/13	10/31/13	wisky	1
GPCR Test	CLOSED	10/09/13	10/03/14	alathb	1
easy	CLOSED	10/09/13	10/31/16	alex90	0
easy	CLOSED	10/09/13	12/31/16	alex90	1
Lab Sequence	CLOSED	10/16/13	10/01/14	Orangeutan	1
Open Design Test	CLOSED	10/18/13	10/19/13	picklion	1
Come and Play	CLOSED	10/31/13	10/22/16	roxyroxy	0
Private Contest	CLOSED	10/21/13	10/23/13	theOMGmonster	0
Extra credit for exam	CLOSED	10/23/13	10/31/13	jcnichols	37
progesterone reductase	CLOSED	10/25/13	10/25/14	sarahoconnor	0
Contest	CLOSED	10/25/13	10/27/13	DDarling	2
utaca	CLOSED	10/25/13	11/15/16	utaca	1
DAYDER VIRTUALIZATION	CLOSED	10/30/13	10/20/14	Roman Rozin	0
MPI	CLOSED	10/31/13	11/30/13	Mengzzz	19
My first contest))	CLOSED	11/01/13	11/07/13	krytoy1	0
Design test	CLOSED	11/01/13	11/30/13	wisky	1
Beginner Alignment Puzzle	CLOSED	11/03/13	11/30/13	Chris123	1
Valentine's day	CLOSED	11/06/13	02/14/14	Compassionate	1
Test Contest	CLOSED	11/06/13	01/31/14	Roukess	1
test2	CLOSED	11/06/13	01/31/14	Roukess	1
GTPase Ras	CLOSED	11/10/13	11/10/14	MyFines	0
fun	CLOSED	11/21/13	12/31/16	ninjaeliot	1
Yo dawg	CLOSED	11/25/13	11/30/13	HelloKittyIslandAdventure	1
Obliged to try that!	CLOSED	12/01/13	02/28/14	Gabs_the_lil_protein	1
IVa2	CLOSED	11/03/14	12/20/14	paul.kascak	1
IVa2	CLOSED	11/14/14	11/30/14	paul.kascak	1
IVa2	CLOSED	11/23/14	11/07/15	paul.kascak	1
sang contesy	CLOSED	11/30/13	12/09/13	swl2013	1
what is this???	CLOSED	12/02/13	12/05/13	Niiikola	2
free style 101	CLOSED	12/02/13	12/25/13	Jaceno	9
The Marathon of Foldit: 611 residues big puzzle chalenge	CLOSED	12/03/13	12/02/16	Bruno Kestemont	22
Client Tests	CLOSED	12/04/13	12/31/16	Matthew Krueger	28
stress responsive protein [Porphyromonas gingivalis SJD2]	CLOSED	12/06/13	12/12/14	DashaDv	1
Ligand Practice	CLOSED	12/07/13	12/16/13	slofgren	1
40 freestyle	CLOSED	12/09/13	12/05/16	DashaDv	1
dimer test	CLOSED	12/09/13	12/15/16	syoifczeri	1
Fight AIDS	CLOSED	12/09/13	12/31/16	Matthew Krueger	290
Freestyle Design a 500 length Protein!	CLOSED	12/09/13	12/31/16	Matthew Krueger	43
Total freedom	CLOSED	12/09/13	12/10/13	ahaddad	1
Protein Laboratory	CLOSED	12/10/13	12/25/13	slofgren	1
trimer test	CLOSED	12/11/13	12/31/15	syoifczeri	1
Whatever You Want	CLOSED	12/20/13	12/21/13	The Super Cat	0
Polite	CLOSED	12/21/13	04/25/14	Spark5	2
manners	CLOSED	12/21/13	02/28/14	Spark5	1
ABCDEFG HIJK	CLOSED	12/21/13	01/05/14	Spark5	1
Test 611	CLOSED	12/27/13	12/28/13	NickyCGS	1
Trimer design	CLOSED	12/28/13	12/28/14	arivero	1
popopop	CLOSED	12/28/13	12/31/13	swl2013	1
Testing ground 3	CLOSED	12/30/13	12/30/14	slofgren	1
testing Foldit minimize split intein 3NZM	CLOSED	01/02/14	01/02/16	sagearbor	2
Create-a-Protein I	CLOSED	01/04/14	01/11/14	PennyfromHeaven	1
SaLLIa666 Game	CLOSED	01/08/14	01/12/14	SaLLIa666	1
AIDS ATTACK	CLOSED	01/08/14	12/31/17	Luciana	1
Sparky	CLOSED	01/09/14	03/09/14	Spark6	1
carlos	CLOSED	01/18/14	01/19/14	phillida	1
carlos	CLOSED	01/10/14	01/11/14	bharani94	2
Urena	CLOSED	01/11/14	01/12/14	robertito	1
owen	CLOSED	01/13/14	01/20/14	owen9o930	0
MGC 2014	CLOSED	01/16/14	01/22/14	Kimbostu	1
BIOL225 2014	CLOSED	01/16/14	01/22/14	Kimbostu	9
My 500 Test	CLOSED	01/17/14	02/24/14	BCAA	1
missing side chains	CLOSED	01/24/14	02/23/14	apoma	0
Wulff's Fantastic Core Challenge	CLOSED	01/27/14	02/28/14	-Jacoby-	12
GTPase Ras Long b [Open to all] [Open discussion]	CLOSED	01/28/14	12/31/17	AsDawnBreaks	169
Golden Goose	CLOSED	01/29/14	01/30/14	Maverik_Goose	0
R3	CLOSED	01/29/14	01/30/14	maverickandgoose	1
Red Block 2 \| The Foldit Games	CLOSED	01/30/14	02/07/14	xXF4T3D_P4R4D0Xx	6
The Marathon of Foldit - New Chapter	CLOSED	02/01/14	02/28/17	Bruno Kestemont	126
Funny	CLOSED	02/01/14	04/06/14	Spark6	1
test arla	CLOSED	02/07/14	02/14/14	arlap	1
test arla 2	CLOSED	02/07/14	02/14/14	arlap	1
test arla 3	CLOSED	02/07/14	02/14/14	arlap	0
test	CLOSED	02/12/14	02/13/14	l_like	2
ligand test	CLOSED	02/13/14	02/12/15	syoifczeri	1
Test1212	CLOSED	02/14/14	02/15/14	NickyCGS	1
Test1313	CLOSED	02/14/14	02/15/14	NickyCGS	1
Test contest	CLOSED	02/14/14	02/15/14	NickyCGS	1
D	CLOSED	02/17/14	02/24/14	MurloW	1
Mean, lean, crumple machine	CLOSED	02/20/14	06/22/14	mind_hack	1
Clayton Biochemistry Spring 2014	CLOSED	02/24/14	05/01/14	rsingiser	11
mutate_test	CLOSED	02/25/14	04/25/14	robgee	1
1	CLOSED	02/26/14	02/27/14	egilleh	1
jhdfksaufsahkmd	CLOSED	02/28/14	03/02/14	spider876	2
Test	CLOSED	03/03/14	03/05/14	PeerPride	1
Trest	CLOSED	03/02/14	03/13/14	PeerPride	1
Test	CLOSED	03/03/14	03/13/14	PeerPride	0
Seal Myoglobin	CLOSED	03/03/14	03/09/14	PeerPride	0
drim	CLOSED	03/05/14	03/06/14	emulhall	0
Freestyle Design 100 Sandbox	CLOSED	03/06/14	03/31/17	viosca	1
AntProtFly	CLOSED	03/06/14	03/05/15	Flagg65a	1
AntProtFly2	CLOSED	03/06/14	03/05/15	Flagg65a	1
Raf kinase inhibitor	CLOSED	03/07/14	03/30/14	pongoo	1
Biol. 312 project	CLOSED	03/10/14	04/29/14	Claire_Rinehart	1
Freestyle 40	CLOSED	03/13/14	03/14/14	Shpooom	1
IQS protein folding contest 2014	CLOSED	03/17/14	03/31/14	xevi.biarnes	1
Freestyle Design 80	CLOSED	03/19/14	03/20/14	thoyt2012	1
test20	CLOSED	03/20/14	03/20/17	Jean-Bob	1
De Novo Folding of Auts2	CLOSED	03/24/14	06/24/14	ACastanza	1
lost points test case	CLOSED	03/26/14	12/25/14	brgreening	1
HIV protease	CLOSED	03/27/14	04/04/14	Professor West	11
Test32714	CLOSED	03/27/14	03/28/14	NickyCGS	1
Testmarch2714	CLOSED	03/27/14	03/28/14	NickyCGS	1
Test 327	CLOSED	03/27/14	03/28/14	NickyCGS	1
test 80 trimer 327	CLOSED	03/27/14	03/28/14	NickyCGS	2
Test Contest 327	CLOSED	03/27/14	03/28/14	NickyCGS	1
702	CLOSED	04/01/14	06/29/14	csqu001	1
702	CLOSED	04/01/14	06/01/14	csqu001	1
Freestyle Symmetric Design: 40 Dimer	CLOSED	04/04/14	04/11/14	test_account1	0
Freestyle Symmetric Design: 40 Trimer	CLOSED	04/04/14	04/11/14	test_account1	0
Freestyle Symmetric Design: 80 Dimer	CLOSED	04/04/14	04/11/14	test_account1	0
Freestyle Symmetric Design: 80 Trimer	CLOSED	04/04/14	04/11/14	test_account1	0
40-2	CLOSED	04/09/14	04/16/14	test_account1	2
40-3	CLOSED	04/09/14	04/16/14	test_account1	2
80-2	CLOSED	04/09/14	04/16/14	test_account1	1
80-3	CLOSED	04/09/14	04/16/14	test_account1	1
500 for intermediate and beginning players	CLOSED	04/15/14	04/29/14	Andres186000@gmail.com	1
Freestyle DC	CLOSED	04/23/14	05/28/14	spearandmagichelmet	1
vlp de filette	CLOSED	04/23/14	05/31/14	alexram99	1
Sup'bio02	CLOSED	04/24/14	04/27/14	isaa54	12
Supbiotech A	CLOSED	04/24/14	04/25/14	ChloeAudrey	10
Butt	CLOSED	04/24/14	04/25/14	dlaplaca	1
test	CLOSED	04/25/14	04/26/14	kasper42	1
lost points test two	CLOSED	04/25/14	04/25/17	brgreening	1
Test 42514	CLOSED	04/25/14	04/26/14	NickyCGS	1
design DNA?	CLOSED	04/29/14	04/30/16	kibakabul	1
Biostructure Contest	CLOSED	05/07/14	05/08/14	Komsomolez	7
Amazing	CLOSED	05/13/14	05/18/14	Botanix	0
Test, festyn bibs	CLOSED	05/15/14	05/19/14	Behoston	2
Dino contest	CLOSED	05/14/14	05/15/14	isabelfer	2
test frizzled	CLOSED	05/16/14	05/17/14	Seth Cooper	1
Frizzled test	CLOSED	05/16/14	05/24/14	fankong	1
test nanog	CLOSED	05/16/14	05/17/14	Seth Cooper	1
test abeta	CLOSED	05/16/14	05/17/14	Seth Cooper	1
test abeta 2	CLOSED	05/16/14	05/17/14	Seth Cooper	1
indi 500 segment race	CLOSED	05/17/14	12/31/17	jeshprabakaran	1
the	CLOSED	05/19/14	05/20/14	HAI-YU CHENG	1
Foldit tura pierwsza	CLOSED	05/23/14	05/25/14	Behoston	17
Test design	CLOSED	05/29/14	05/30/14	Valectar	1
Testing200	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST1	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST2	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST3	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST4	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST5	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST6	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST7	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST8	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST9	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST10	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST11	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST12	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST13	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST14	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST15	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST16	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST17	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST18	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST19	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST20	CLOSED	05/30/14	05/31/14	NickyCGS	1
ConTEST21	CLOSED	05/30/14	05/31/14	NickyCGS	1
Abeta Binder Piecewise Design	CLOSED	05/30/14	06/21/14	fankong	2
test test 12345	CLOSED	06/04/14	06/05/14	Seth Cooper	0
new test	CLOSED	06/03/14	06/04/14	test_account1	1
Freestyle VarLength	CLOSED	06/08/14	06/30/14	Bithalbierer	1
Myoglobin	CLOSED	06/08/14	06/15/14	Bithalbierer	1
test100	CLOSED	06/10/14	06/11/14	Seth Cooper	1
test150	CLOSED	06/10/14	06/11/14	Seth Cooper	1
test200	CLOSED	06/10/14	06/11/14	Seth Cooper	1
Fight Liver Cancer	CLOSED	06/12/14	12/31/14	retroneo	1
prejudice on HIV	CLOSED	06/13/14	12/16/14	manasa	1
Test Dimer	CLOSED	06/30/14	07/28/14	jflat06	1
Test Trimer	CLOSED	06/30/14	07/28/14	jflat06	1
DrCBDmon	CLOSED	06/15/14	06/30/14	angenentmari	1
test nanog	CLOSED	06/17/14	06/18/14	test_account1	1
lilovip01	CLOSED	06/22/14	07/22/14	lilovip	1
Sandboxing, private pls	CLOSED	07/04/14	07/04/15	Thardus	1
Abeta contest CampBIOmed	CLOSED	07/09/14	07/11/14	kaurg	3
Nanog Transcription Factor Contest - CampBIOmed	CLOSED	07/15/14	07/16/14	kaurg	10
Abeta protein CampBIOmed	CLOSED	07/15/14	07/20/14	kaurg	7
nanog	CLOSED	07/17/14	07/24/14	oli-popxD	1
frezae	CLOSED	07/18/14	08/31/14	frezae	0
:P Fold it	CLOSED	07/25/14	08/09/14	I-Love-Computers	1
hankg10	CLOSED	07/28/14	07/29/14	hankg10	1
AZV 1	CLOSED	07/28/14	08/09/14	azvolpe	1
Nanog Transcription factor contest	CLOSED	07/29/14	07/31/14	kaurg	3
ABETA PROTEIN COMPETITION	CLOSED	07/29/14	08/01/14	kaurg	4
20 amino acid-- protein	CLOSED	08/06/14	08/24/14	Barbaramoshi	0
Immunoglobulin D Hinge H1	CLOSED	08/06/14	08/17/14	frogzorz	0
Camp BIOmed NANOG contest	CLOSED	08/11/14	08/13/14	kaurg24	6
Amyloid Beta contest - CampBIOmed	CLOSED	08/12/14	08/14/14	kaurg24	6
Cux1 p110 Cleavage Domain, 440-753	CLOSED	08/12/14	08/19/14	antoine777	1
Test	CLOSED	08/12/14	08/13/14	antoine777	1
figure it out	CLOSED	08/14/14	08/18/14	crush2112	1
HIV	CLOSED	08/15/14	06/30/15	Test Lab	1
Freestyle design 40 pc	CLOSED	08/17/14	09/17/14	Serraglio	0
thiinngyyy cathole	CLOSED	08/19/14	08/31/14	aguy77	0
The National Protein Test	CLOSED	08/22/14	08/29/14	azak2002	1
bZIP	CLOSED	08/28/14	09/18/14	sven1103	1
test	CLOSED	09/27/14	06/25/15	srettie	1
Small Peptides	CLOSED	09/27/14	11/30/14	Batz	1
Stefano Fuschetto	CLOSED	09/30/14	07/22/16	Stefano Fuschetto	0
Flute lets go son	CLOSED	09/30/14	10/01/14	FluteJasonKarakaedos	3
test	CLOSED	10/01/14	10/01/15	Orcus	1
AMES #1 experement	CLOSED	10/07/14	10/31/14	foldase555	1
AMES Science fair made me do it	CLOSED	10/07/14	10/31/14	foldase555	1
foldit pro	CLOSED	10/08/14	10/09/14	otterballer	1
show your protein	CLOSED	10/10/14	10/30/14	Hydromaker107	0
vanabin	CLOSED	10/10/14	10/11/14	polli8	1
Putative Plant Protein	CLOSED	10/10/14	10/31/14	Mecklenburger Friese	1
Miso: a critical protein for mosquito reproduction	CLOSED	10/14/14	10/01/16	asmidler	1
Miso try 2	CLOSED	10/14/14	10/01/17	asmidler	1
FirstTry	CLOSED	10/15/14	10/17/14	Waverka.10	2
MedChem14	CLOSED	10/16/14	10/27/14	pedrofong	3
Atg1 Protein	CLOSED	10/17/14	12/31/14	Mecklenburger Friese	1
Hypotethical Protein ATU0225	CLOSED	10/21/14	10/09/15	gorrila13	1
A#1284	CLOSED	10/22/14	11/30/14	Liam0289	1
Bioc EC Fall 2014	CLOSED	10/28/14	11/15/14	jcnichols	32
testing	CLOSED	10/31/14	11/01/14	ipcfg	1
yo	CLOSED	10/31/14	11/01/14	otterballer	1
Biotek Esp	CLOSED	11/04/14	11/11/14	Henriksk	1
C4lab-Friendly Contest	CLOSED	11/04/14	11/23/14	yi-an Tung	7
New_contest	CLOSED	11/07/14	12/09/14	pedrofong	0
New_contest	CLOSED	11/07/14	12/09/14	pedrofong	14
test test	CLOSED	11/08/14	11/30/14	obiwan	0
test test	CLOSED	11/10/14	11/30/14	obiwan	0
Best Design	CLOSED	11/09/14	11/30/14	David_M1231	0
zincfingers	CLOSED	11/20/14	02/18/15	chingsong2	1
coursework	CLOSED	11/20/14	12/31/14	chingsong	27
course work test	CLOSED	11/21/14	12/31/14	chingsong	1
TFP	CLOSED	11/21/14	12/31/14	chingsong2	1
test 80 segment	CLOSED	11/23/14	11/26/15	brgreening	1
80 Segments Each	CLOSED	11/24/14	12/23/14	ElliottB1	1
Test Post Please Ignore	CLOSED	11/24/14	11/25/14	rjking01	0
SH3PX1	CLOSED	11/25/14	02/28/15	Patrick1116	0
SH3PX1	CLOSED	11/25/14	02/28/15	Patrick1116	0
SH3PX1	CLOSED	11/25/14	02/28/15	Patrick1116	1
SH3PX1	CLOSED	11/25/14	02/28/15	Patrick1116	0
SH3PX1	CLOSED	11/25/14	02/28/15	Patrick1116	0
TFP200	CLOSED	11/25/14	12/31/14	chingsong2	2
design test	CLOSED	11/27/14	11/30/15	ipcfg	1
First puzzle	CLOSED	11/29/14	12/03/14	r.gore	1
dimer a-helix coiled-coil	CLOSED	11/29/14	12/05/14	r.gore	1
Frizzled Design Contest	CLOSED	11/30/14	12/06/14	ingoneato	14
Biophysical chemistry workshop University of Edinburgh Test	CLOSED	12/19/14	12/03/15	jmichel80	16
Design_test	CLOSED	12/03/14	12/04/14	bkoep	2
RevDimer	CLOSED	12/04/14	12/05/14	Tanamura	1
HIV protease contest	CLOSED	12/04/14	12/07/14	DrewNyeTheScienceGuy	0
conTest	CLOSED	12/04/14	12/12/14	jflat06	1
conTest2	CLOSED	12/04/14	12/12/14	jflat06	1
BIOC530	CLOSED	12/04/14	12/12/14	bkoep	46
Small test 20 segment	CLOSED	12/05/14	12/01/15	aninweton	1
small test variable length	CLOSED	12/05/14	12/05/15	aninweton	1
Hiv	CLOSED	12/07/14	12/01/15	dbuske	4
helix	CLOSED	12/09/14	12/31/15	ivalnic	1
test	CLOSED	12/11/14	12/12/14	Bloch_Party	1
test	CLOSED	12/12/14	12/13/14	bkoep	1
Best holiday design	CLOSED	12/21/14	12/31/14	Skippysk8s	8
I Dare You!!!	CLOSED	01/09/15	01/10/15	nakul_0702	0
Come at me Bro	CLOSED	01/08/15	01/12/15	GentlestElm29	0
Lets have fun	CLOSED	01/11/15	01/13/15	imenm	3
my bioinfo assinment	CLOSED	01/17/15	02/12/15	c0d3w4rri0r	1
my bio info assinment version 2	CLOSED	01/17/15	02/01/15	c0d3w4rri0r	1
HIV Protease - BIOL225	CLOSED	01/22/15	01/29/15	Siderhurst	11
Make a Greek Key	CLOSED	01/27/15	02/10/15	jakelmer	0
x	CLOSED	01/22/15	02/18/15	jakelmer	1
Greek Key Challenge	CLOSED	01/25/15	02/10/15	jakelmer	12
Freestyle Design 40	CLOSED	01/27/15	01/31/18	HerobrinesArmy	1
Freestyle Design 20	CLOSED	01/27/15	01/31/18	HerobrinesArmy	1
Freestyle Design 40	CLOSED	01/30/15	12/31/15	Hutty	1
Freestyle150	CLOSED	01/30/15	01/30/17	queentut16	1
trial	CLOSED	02/04/15	02/08/15	jort	1
normal contest	CLOSED	02/04/15	02/05/15	deephama001	1
the ice dragons playhouse	CLOSED	02/06/15	02/28/15	the ice dragon	3
Fold It League Preseason Scrimmage	CLOSED	02/06/15	02/14/15	DGOVIL	0
testmb	CLOSED	02/10/15	02/12/15	jakelmer	1
test	CLOSED	02/10/15	02/10/16	silverberg	3
Greek Key Test	CLOSED	02/11/15	03/11/15	kirkngrant	1
Greek Key Test Run	CLOSED	02/11/15	03/11/15	kirkngrant	0
You choose the number of residues	CLOSED	02/11/15	02/28/18	michaeldee	20
Abeta Binder	CLOSED	02/11/15	12/31/18	michaeldee	296
Nanog Transcription Factor	CLOSED	02/11/15	12/31/18	michaeldee	81
Frizzled Design Puzzle Contest	CLOSED	02/11/15	12/31/18	michaeldee	42
Testacular	CLOSED	02/22/15	03/30/15	HerobrinesArmy	0
mTOR	CLOSED	02/23/15	02/23/18	kurenan	1
freestyle 20	CLOSED	02/24/15	02/24/16	manasa	1
Porin	CLOSED	02/27/15	03/02/15	Jonathan51	1
Private Contest	CLOSED	02/27/15	02/28/16	babacon	1
test	CLOSED	03/03/15	03/04/15	boltax	1
block II test	CLOSED	03/03/15	03/04/15	boltax	1
protein 3AB [Enterovirus C]	CLOSED	03/08/15	05/08/15	orangejayo1	1
Testing 150	CLOSED	03/09/15	03/27/15	HerobrinesArmy	1
HbA1 Test	CLOSED	03/11/15	03/12/15	minecraft4ever4	0
HBA1 Test	CLOSED	03/11/15	03/13/15	minecraft4ever4	1
HBA1 Test2	CLOSED	03/11/15	03/12/15	minecraft4ever4	1
dyfhyh yghdrh	CLOSED	03/11/15	03/15/15	minecraft4ever4	1
G-quadruplex	CLOSED	03/14/15	03/02/16	kapick84	0
Seymoue	CLOSED	03/16/15	03/19/15	ChAda2015	0
Exam 2 EC Spring 2015	CLOSED	03/27/15	04/05/15	jcnichols	14
Greek Key V2.0	CLOSED	03/30/15	04/15/15	jakelmer	3
Coiled Helices	CLOSED	03/30/15	04/04/15	Batz	1
Freestyle Design 150	CLOSED	04/02/15	04/10/15	spacexplorer	1
D&A Mess	CLOSED	04/28/15	07/12/15	ChrisScientist	0
HBM	CLOSED	04/12/15	07/26/15	ChrisScientist	1
a	CLOSED	04/06/15	04/14/15	jinxed	1
Michael	CLOSED	04/26/15	04/28/16	jinxed	2
Test auto	CLOSED	04/11/15	04/12/15	wudoo	0
linker	CLOSED	04/11/15	04/30/15	463418196@qq.com	1
Trp-Cage	CLOSED	04/14/15	04/14/18	ivalnic	1
killen	CLOSED	04/23/15	04/24/15	woops	7
P98	CLOSED	04/23/15	04/30/16	hphilipp	1
aaa	CLOSED	04/26/15	05/15/15	mak3e	1
Just For Begginers	CLOSED	04/29/15	04/30/15	timothyu120	1
cenpH	CLOSED	05/07/15	08/07/15	josephab	1
Check Cartesian Bug	CLOSED	05/11/15	06/30/15	brgreening	1
Helix	CLOSED	05/13/15	05/15/15	dendixon	0
test 1111	CLOSED	05/15/15	12/31/15	cyj101366	0
helix test	CLOSED	05/18/15	05/27/15	dendixon	1
Hel	CLOSED	05/19/15	05/19/19	ivalnic	1
BF Mol Dynamics	CLOSED	05/22/15	05/25/15	Ivelina Zaharieva	7
Contest #1	CLOSED	05/30/15	05/30/16	pizpot	2
bioinf	CLOSED	06/06/15	06/10/15	23RPE	1
bioinf01	CLOSED	06/06/15	06/10/15	23RPE	1
bioinf02	CLOSED	06/06/15	06/10/15	23RPE	0
HIV protease BK	CLOSED	06/10/15	06/11/15	bkoep	1
Freestyle Design 500	CLOSED	06/15/15	06/22/15	pipos1	1
Folding con	CLOSED	06/16/15	06/16/16	zedOFF	0
Test contest for a project at TU Clausthal	CLOSED	06/20/15	06/21/18	Shanschke	1
GTPase Ras Fold	CLOSED	06/25/15	07/01/15	BlockheadXX	0
Protein Folding with Point mutations	CLOSED	07/28/15	06/16/18	emernic	1
Freestyle 500	CLOSED	06/30/15	06/15/18	emernic	1
Guanlin_HUST	CLOSED	07/03/15	07/03/16	Guanlinli	1
Camp BIOmed 2015 Week1	CLOSED	07/06/15	07/10/15	apklock	5
Freestyle 40	CLOSED	07/07/15	07/08/15	LKluke	1
Quinoa Test	CLOSED	07/09/15	07/31/15	dinoboy11	1
freestyle	CLOSED	07/11/15	09/30/15	felix1998	0
Camp BIOmed 2015 Week2	CLOSED	07/13/15	07/17/15	apklock	5
Insulin	CLOSED	07/14/15	07/18/15	Unwise	0
Here we go	CLOSED	07/14/15	07/18/15	Unwise	1
Peptides to design	CLOSED	07/26/15	01/01/16	Brabrax	0
Camp BIOmed week 4	CLOSED	07/27/15	07/31/15	apklock	6
Freestyle Design 40	CLOSED	07/28/15	08/01/15	the wheat thin	1
A4 test	CLOSED	07/30/15	08/04/15	rohtem	1
46 Kris	CLOSED	07/31/15	08/07/15	kristoferkeiser	0
Erv46 Kris	CLOSED	07/31/15	08/07/15	kristoferkeiser	1
We are bored - Design Trimer Contest	CLOSED	08/02/15	08/16/15	jamiexq	9
Week 5 Camp BIOmed	CLOSED	08/03/15	08/07/15	apklock	6
Final Project	CLOSED	08/04/15	08/31/15	megskene	1
lilovip-tests-02	CLOSED	08/05/15	08/31/18	lilovip	1
For Science	CLOSED	08/07/15	09/30/15	HDRH	0
test	CLOSED	08/13/15	08/14/15	sungwon	1
Trial	CLOSED	08/17/15	08/20/15	OlgaRadchuk	1
Camp BIOmed 2015 Week 7	CLOSED	08/17/15	08/21/15	apklock	7
Duquesne PJAS 1	CLOSED	09/25/15	09/27/15	pink_cupcakes	9
Duquesne PJAS 2	CLOSED	09/25/15	09/27/15	pink_cupcakes	1
Duquesne PJAS 3	CLOSED	09/25/15	09/27/15	pink_cupcakes	1
Duq Test	CLOSED	09/10/15	09/11/15	pink_cupcakes	1
Design 200	CLOSED	09/13/15	09/30/15	TheFlagellum	0
Oakwood Honors Bio Contest	CLOSED	09/17/15	09/30/15	elightrake	1
Real Oakwood Honors Bio Contest	CLOSED	09/17/15	09/30/15	elightrake	4
test 1	CLOSED	09/23/15	10/31/15	honeypiebeatles	1
Happier	CLOSED	09/30/15	09/30/18	ferricst8	1
AtuJ1E6-cpGFP	CLOSED	10/01/15	10/31/18	Lemons	1
STD	CLOSED	10/01/15	12/31/18	Smellis	0
Chem2208	CLOSED	10/02/15	10/03/15	u5586300	2
Test DANIELLE	CLOSED	10/04/15	10/17/15	petetrig	1
USTB work	CLOSED	10/09/15	10/10/15	chingsong	1
GCN-4 Bipy	CLOSED	10/14/15	10/16/15	LiamMarshall	0
Moe	CLOSED	10/21/15	10/01/16	ivalnic	1
yoyoyo	CLOSED	10/24/15	12/03/15	Aria Deng	2
AP BIO Pd. 3	CLOSED	10/28/15	11/03/15	smuheisen1	0
chase	CLOSED	10/28/15	10/29/15	ChaseLehr1234	1
EC Fall15	CLOSED	10/30/15	11/15/15	jcnichols	1
EC Fall15	CLOSED	10/29/15	11/15/15	jcnichols	14
Test	CLOSED	11/08/15	11/30/15	Skulduggery	1
test 2	CLOSED	11/09/15	12/25/15	Skulduggery	1
Yay!	CLOSED	11/10/15	11/17/15	code cat	1
outer envelope protein 80 [Arabidopsis thaliana]	CLOSED	11/12/15	01/05/16	swimbug2014	0
outer envelope protein 80 [Arabidopsis thaliana]	CLOSED	11/11/15	01/06/16	swimbug2014	1
Freestyle 80 Trimer	CLOSED	11/11/15	12/20/16	AryehK	1
easron	CLOSED	11/16/15	11/17/15	EastonSickels1234	2
SHS	CLOSED	11/20/15	11/21/15	fanerdbcshs	4
Leishmania donovani Ornithine decarboxylase	CLOSED	11/20/15	11/25/15	mikroplasma	2
Test	CLOSED	11/23/15	11/24/15	crostomily	0
Test contest	CLOSED	11/23/15	11/24/15	seantan	1
win or lose	CLOSED	11/28/15	12/01/15	spider876	0
3. y biometrix	CLOSED	11/30/15	11/30/16	blomsterman	2
JJT twincombo	CLOSED	11/30/15	01/31/16	Canadian KId	2
Practice Contest	CLOSED	12/10/15	12/11/15	crostomily	8
test	CLOSED	12/02/15	12/03/15	seantan	0
King of the Class	CLOSED	12/10/15	12/11/15	crostomily	6
testing	CLOSED	12/04/15	12/08/15	vkalas	1
invite only	CLOSED	12/04/15	12/04/16	vkalas	1
SymmetryTest	CLOSED	12/07/15	12/08/15	Batz	1
PRACTICE TEST 1	CLOSED	12/08/15	12/09/15	seantan	3
PRACTICE TEST 2	CLOSED	12/08/15	12/09/15	seantan	3
Swaggy Folding	CLOSED	12/10/15	12/15/15	Atsnider	0
DIY Protein (A Big One)	CLOSED	12/11/15	12/31/15	Atombryan	1
Easy DIY Protein (For more precision then the other one)	CLOSED	12/11/15	12/31/15	Atombryan	2
HIV solvers	CLOSED	12/31/15	04/01/16	Sammie123	1
Freestyle Design	CLOSED	12/16/15	12/25/15	01010011111	1
Freestyle Design 20	CLOSED	12/16/15	12/31/15	01010011111	1
Contest Template Test	CLOSED	12/21/15	12/31/15	01010011111	1
Merry post-christmas	CLOSED	12/25/15	12/28/15	-x-	1
161	CLOSED	12/26/15	12/31/15	shunsuketagami	1
di trimmer ligand version	CLOSED	12/31/15	05/01/16	ChrisScientist	1
ligamaze	CLOSED	12/31/15	03/31/16	ChrisScientist	1
Freestyle Design 200	CLOSED	01/11/16	01/01/17	01010011111	1
Freestyle Design 500	CLOSED	01/11/16	01/31/16	01010011111	1
Freestyle Symmetric Design: 80 Trimer	CLOSED	01/15/16	01/31/16	01010011111	1
HIV protease - BIOL225	CLOSED	01/28/16	02/04/16	Siderhurst	11
Ice-structuring protein	CLOSED	02/01/16	02/29/16	Tajuton_potilas2	1
CLASS CONTEST	CLOSED	02/29/16	03/31/16	Herojohn17	0
peter and kim	CLOSED	02/03/16	04/02/16	petetrig	1
peter and kim	CLOSED	02/03/16	06/11/16	petetrig	1
Freestyle Design 20	CLOSED	02/08/16	02/29/16	01010011111	1
Biophysical chemistry workshop - University of Edinburgh	CLOSED	02/08/16	04/25/16	jmichel80	12
Group V Biophysics BITSG	CLOSED	02/09/16	05/16/16	SandyVii	1
AMP1	CLOSED	02/15/16	02/17/16	grubbybio	1
Miami University	CLOSED	02/18/16	02/21/16	dirk41	1
Teste	CLOSED	02/25/16	02/12/19	NotEvenTryingM8	1
Pseudomonas aeruginosa PA4063	CLOSED	02/28/16	03/31/16	mutinus	1
Contest name	CLOSED	03/03/16	03/04/16	Kristian Rodman	0
HIV Protease	CLOSED	03/16/16	06/01/16	CureForDiabetes	1
WSC Bioc Spring 2016	CLOSED	03/25/16	04/10/16	jcnichols	18
sgner	CLOSED	04/07/16	04/08/16	sgner	0
sgner1	CLOSED	04/07/16	04/08/16	sgner	1
sgnerTEST	CLOSED	04/07/16	04/08/16	sgner	1
Contest	CLOSED	04/14/16	04/15/16	mxwly	3
Fold it!	CLOSED	04/19/16	06/19/16	krzysztofbulenger	0
Fomento CS	CLOSED	04/19/16	04/29/16	fomento00	1
Freestyle RRM	CLOSED	04/22/16	11/29/16	obiwan	0
Freestyle RRM	CLOSED	04/22/16	11/29/16	obiwan	0
Baltyho prirozeni zda se byt smesne male	CLOSED	04/28/16	04/29/16	MMBP2016-HonJi	1
ERN-Transmembran	CLOSED	04/29/16	04/30/16	zduzgun	1
DENE	CLOSED	04/30/16	05/01/16	zduzgun	1
Test Contest - ML	CLOSED	05/01/16	08/31/16	MrMark2014	3
Viral accessory protein	CLOSED	05/03/16	05/22/16	Zephrin	1
Two symmetric chains, 40 segments each; all can be designed.	CLOSED	05/03/16	05/05/16	zduzgun	1
Contest Template Test	CLOSED	05/04/16	05/06/16	zduzgun	1
An 500 segment extended chain that can all be designed.	CLOSED	05/04/16	05/06/16	zduzgun	1
This freestyle puzzle has mutable residues and allows you to add or delete residues	CLOSED	05/04/16	05/06/16	zduzgun	1
Freestyle Design 20	CLOSED	05/09/16	05/29/16	01010011111	1
Zia	CLOSED	05/17/16	08/27/16	Ziauddin Ahmer	0
Lac repressor	CLOSED	05/17/16	05/24/16	dunawayjacob	1
Protein Stability	CLOSED	05/31/16	12/31/16	Alisa Southerncross	0
GTPase	CLOSED	06/02/16	09/15/16	yjguo_10	0
ARSB	CLOSED	06/10/16	07/29/16	szeitler18	0
test	CLOSED	07/12/16	07/13/16	guolab	1
1	CLOSED	07/22/16	07/23/16	liyixiao	1
20 segment extended chain that can all be designed.	CLOSED	07/27/16	08/12/16	01010011111	1
BendBobsPlayItYourWay	CLOSED	07/28/16	07/28/19	bendbob	1
1	CLOSED	08/04/16	08/06/16	rossco0407	1
Practice_folding_from_scratch	CLOSED	08/22/16	12/01/16	Miguel.alj390	1
TIM Barrel Design	CLOSED	08/29/16	09/02/16	Rsteele7	1
TIM Barrel Design	CLOSED	08/29/16	09/02/16	Rsteele7	1
TIM Barrel	CLOSED	09/01/16	09/09/16	Rsteele7	1
TIM 200	CLOSED	09/01/16	09/09/16	Rsteele7	1
Help Cure HIV	CLOSED	09/05/16	09/30/16	Toyo	1
GTPase Ras	CLOSED	09/16/16	12/08/16	hgenzman21	1
DuquesnePJAS1	CLOSED	09/23/16	09/25/16	EmilyB	6
DuquesnePJAS2	CLOSED	09/23/16	09/25/16	EmilyB	6
DuquesnePJAS3	CLOSED	09/23/16	09/25/16	EmilyB	6
Biochem-AD16	CLOSED	09/23/16	10/07/16	Yocan	1
LOL FU	CLOSED	09/30/16	10/30/16	BroC4	1
CH 410 Puzzle 1	CLOSED	11/30/16	12/13/16	ProfCollins	15
test 1	CLOSED	09/27/16	09/29/16	ionickiwi	1
Variable Length Protein Structure	CLOSED	09/29/16	12/31/16	Atombryan	1
Sandbox	CLOSED	09/30/16	10/02/16	CollBio	1
my contest	CLOSED	10/01/16	10/30/16	Carlos Santamaria	1
Test	CLOSED	10/14/16	10/16/16	immac636	1
raid	CLOSED	10/19/16	10/20/16	TheEnderCavalier	1
biyokimya_2016_1	CLOSED	10/19/16	10/23/16	biyokimya_2016_ismailhoca	0
biyokimya_2016_1.hafta	CLOSED	10/19/16	10/23/16	biyokimya_2016_ismailhoca	1
deneme_1	CLOSED	10/19/16	10/20/16	ismailhakkiakgun	1
ismailhakkiakgun	CLOSED	10/19/16	10/24/16	ismailhakkiakgun	1
raid 2	CLOSED	10/20/16	10/21/16	TheEnderCavalier	1
WSU Bioc Fall 16	CLOSED	10/20/16	11/03/16	jcnichols	2
Raid 3	CLOSED	10/21/16	10/22/16	TheEnderCavalier	0
WSU Fall 16 Biochemistry	CLOSED	11/02/16	11/20/16	jcnichols	17
My Contest	CLOSED	11/04/16	11/05/16	Benbennett2000	3
Breakfast of Champions	CLOSED	11/04/16	11/10/16	bowman1334	1
Biochem 124	CLOSED	11/12/16	11/13/16	John Carlo dela Cruz	0
Eric's Test	CLOSED	11/15/16	11/17/16	ebrenner14	1
test-tintin-hiv	CLOSED	11/22/16	11/23/16	tintin1343	1
Practice Space--FREESTYLE: VARIABLE LENGTH	CLOSED	11/24/16	11/21/18	Puttering	1
Practice Space--SEAL MYOGLOBIN	CLOSED	11/24/16	11/21/18	Puttering	1
BC 124	CLOSED	11/30/16	12/06/16	roandavila	7
Test	CLOSED	12/03/16	12/04/16	Justine18	1
Adventure	CLOSED	12/03/16	12/04/16	Justine18	1
BCH 441 Fold my protein contest	CLOSED	12/04/16	12/05/16	ryanolson41	1
SK SK II	CLOSED	12/04/16	12/31/19	ScratchKid	1
abeta- binder	CLOSED	12/06/16	12/08/16	tintin1343	1
SK III!	CLOSED	12/07/16	12/31/19	ScratchKid	1
BIOL1300/2300-2016 contest	CLOSED	12/09/16	12/31/16	nfawzi	1
Fold like the wind (blow me away)	CLOSED	12/11/16	12/31/16	kath2656	0
BIOL1300/2300 Frizzled	CLOSED	12/12/16	12/31/16	biol1300_nick	21
BIOL1300/2300 Abeta binder	CLOSED	12/12/16	12/31/16	biol1300_nick	20
SK IV	CLOSED	12/29/16	12/31/15	ScratchKid	0
SK V	CLOSED	12/29/16	12/31/19	ScratchKid	1
SK VI	CLOSED	12/29/16	12/31/19	ScratchKid	1
SK VII	CLOSED	12/29/16	12/31/92	ScratchKid	1
1v Foldit-1 F2017	CLOSED	01/05/17	01/18/17	kipasceu	0
1v Foldit 1	CLOSED	01/02/17	01/18/17	kipasceu	1
TrollFace games	CLOSED	01/12/17	01/14/17	TrollFace2002	1
MGC - 2017	CLOSED	01/18/17	01/24/17	Kimbostu	7
HIV PROTEASE	CLOSED	01/18/17	02/01/17	gu14001	0
Collins CH 410	CLOSED	02/01/17	05/10/17	ProfCollins	11
Biochem 463 lab 1	CLOSED	01/24/17	01/25/17	BWeber	1
i	CLOSED	01/27/17	01/30/17	zduzgun	1
test contest	CLOSED	02/07/17	02/28/17	brbfold	1
CHE 8592 Greek Key Challenge	CLOSED	02/09/17	02/16/17	jakelmer	15
iRFP	CLOSED	02/13/17	02/13/20	amao1	1
iRFP 2	CLOSED	02/13/17	02/13/20	amao1	1
AEL	CLOSED	02/14/17	02/15/17	JaeYeong	0
Test Contest for Lorna	CLOSED	02/17/17	02/19/17	dsilva.l	1
axin solve	CLOSED	02/14/17	02/16/17	NiPatFeb2017	1
Dave's challenge of despair	CLOSED	02/23/17	02/24/17	bsdn	0
MC&SDRocks	CLOSED	02/27/17	02/24/18	SunSalutation	2
Miniprotein1L2Y	CLOSED	04/23/17	05/23/17	Bruno Kestemont	4
#awesome	CLOSED	03/02/17	03/03/17	roachfamilymaine	1
Test 3V1A	CLOSED	03/02/17	05/02/17	Scopper	1
Freestyle Design 40 Contest #1	CLOSED	03/06/17	03/13/17	FutureScientist1212	1
Freestyle Design 80 Contest #2	CLOSED	03/13/17	03/20/17	FutureScientist1212	1
test	CLOSED	03/07/17	03/08/17	lhatsk	1
Test	CLOSED	03/12/17	03/14/17	28SciOne	1
Test2	CLOSED	03/12/17	03/19/17	28SciOne	1
Team 5 Project	CLOSED	03/12/17	03/31/17	28SciOne	5
SEAL MYOGLOBIN	CLOSED	03/13/17	05/11/17	srinaldi1656	1
Team 11 Test	CLOSED	03/18/17	03/19/17	50SciOne	2
Science One Team 10 Project	CLOSED	03/20/17	04/01/17	06SciOne	4
team 6!!	CLOSED	03/21/17	03/25/17	20SciOne	5
University of Edinburgh Biophysical chemistry workshop 2017	CLOSED	03/21/17	07/01/17	jmichel80	9
Super Easy	CLOSED	04/01/17	05/03/17	AndriiMiller	1
Chem 365?	CLOSED	04/02/17	04/30/17	koehlr60chem365	1
WSU Bioc 1 S18	CLOSED	04/05/17	04/23/17	jcnichols	16
Forf	CLOSED	04/10/17	04/11/17	Leser	1
200-residue design puzzle test	CLOSED	04/12/17	04/18/17	LociOiling	1
Back to the Future	CLOSED	04/18/17	05/16/17	chingsong	43
3V1A	CLOSED	04/23/17	05/23/17	Bruno Kestemont	9
Structural-Bioinformatics	CLOSED	04/24/17	05/08/17	AnnaSophalK	9
HIV Protease Folding	CLOSED	05/10/17	05/13/17	Komsomolez	6
Check	CLOSED	05/12/17	05/14/17	ProfCollins	1
GeneEngineering	CLOSED	05/16/17	06/15/17	chingsong	68
testComm	CLOSED	07/22/17	08/20/17	dsilva.l	2
freestyle synthetic protein designs	CLOSED	06/12/17	07/12/17	jigs	1
QQ	CLOSED	06/21/17	07/20/17	41607431	1
yuqianhengyuan	CLOSED	06/26/17	06/27/17	yuqianhengyuan	0
freestyle 20	CLOSED	07/25/17	08/22/17	PatricioBato	1
Freestyle 40	CLOSED	07/25/17	08/24/17	PatricioBato	1
contest	CLOSED	08/01/17	08/31/17	folditguy123098	3
Chains!	CLOSED	08/03/17	09/02/17	Mao Mao	1
Custom 500	CLOSED	08/07/17	09/06/17	khendarg	1
Testing	CLOSED	08/23/17	09/21/17	Dr.Chi	0
Cell Bio	CLOSED	08/22/17	08/24/17	Dr.Chi	1
testA1	CLOSED	08/24/17	08/25/17	ksz	1
the fun alot	CLOSED	08/28/17	08/29/17	randcvn	0
Freedom	CLOSED	09/13/17	09/14/17	LilinC33	1
HIV Trouble	CLOSED	09/18/17	09/30/17	LOGOLOZ	1
Ronny-test	CLOSED	09/22/17	09/30/17	ronnygeo	1
Frestyle contest	CLOSED	10/04/17	10/08/17	maximiliancarey	1
Test Custom Contest - dev03	CLOSED	10/09/17	10/12/17	ronnygeo	1
Extracellular peptide	CLOSED	10/18/17	10/25/17	danielofs	1
1V1 ME UNLESS UR SCARED	CLOSED	10/19/17	10/21/17	I dom1nate	0
DONG1 protein	CLOSED	10/20/17	11/11/17	cxlpku	1
test 1	CLOSED	10/20/17	10/31/17	cxlpku	1
Bio-Tech 2k17	CLOSED	10/20/17	10/21/17	JosephNi	9
bend it	CLOSED	10/25/17	11/05/17	Marlfox3	0
WSC Bioc 1 F17 EC	CLOSED	11/03/17	11/18/17	jcnichols	15
me and freinds	CLOSED	11/05/17	11/07/17	Nusayr	1
test123	CLOSED	11/07/17	11/08/17	horowsah	1
Mr Faure 1v1 me lmao 100XDDDDDDDDDDD	CLOSED	11/14/17	11/15/17	B0B0	5
Block 11	CLOSED	11/16/17	11/26/17	drigginar	0
Biochem 1 Extra Credit	CLOSED	11/17/17	12/15/17	ProfCollins	14
USTB2017	CLOSED	11/29/17	12/29/17	chingsong	29
WTF! BOOM	CLOSED	12/01/17	12/03/17	DomasterPM	1
Cool	CLOSED	12/02/17	01/01/18	BaiYang	0
Cool	CLOSED	12/02/17	01/01/18	BaiYang	1
New City Science	CLOSED	12/09/17	12/10/17	caitlin@newcitycharterschool.org	0
ycgE	CLOSED	12/08/17	12/11/17	cjkunze1	0
NCCS weeaboos	CLOSED	12/07/17	12/08/17	sushiboi	0
NCCS weeaboos	CLOSED	12/07/17	12/08/17	sushiboi	0
Werncs	CLOSED	12/07/17	12/08/17	caitlin@newcitycharterschool.org	11
New City Charter School	CLOSED	12/09/17	12/10/17	caitlin@newcitycharterschool.org	43
Global	CLOSED	12/16/17	12/17/17	ckluo	2
A Test Custom Contest	CLOSED	12/29/17	12/31/17	Seth Cooper	0
A Test Custom Contest - fold.it	CLOSED	12/29/17	12/31/17	Seth Cooper	1
A Test Custom Contest 2 - fold.it	CLOSED	12/29/17	12/31/17	Seth Cooper	0
test9	CLOSED	12/29/17	12/30/17	horowsah	1
name name	CLOSED	01/01/18	01/05/18	01010011111	1
name 2	CLOSED	01/01/18	01/20/18	01010011111	1
name 500	CLOSED	01/01/18	01/20/18	01010011111	1
name 150	CLOSED	01/02/18	01/19/18	01010011111	1
Noc Biologów test	CLOSED	01/09/18	01/12/18	decu	1
test17	CLOSED	01/09/18	01/10/18	horowsah	1
asdf	CLOSED	01/09/18	01/31/18	Seth Cooper	0
test18	CLOSED	01/09/18	01/10/18	horowsah	1
test19	CLOSED	01/09/18	01/10/18	horowsah	1
test20	CLOSED	01/09/18	01/10/18	horowsah	1
test21	CLOSED	01/09/18	01/10/18	horowsah	1
test22	CLOSED	01/09/18	01/10/18	horowsah	1
test23	CLOSED	01/09/18	01/10/18	horowsah	1
DUSP6	CLOSED	01/13/18	02/11/18	Bruno Kestemont	1
DUSP6	CLOSED	01/13/18	02/11/18	Bruno Kestemont	1
DU Phosphorous 2018	CLOSED	01/11/18	01/26/18	horowsah	8
DU TAR 2018	CLOSED	01/11/18	02/02/18	horowsah	10
DU Chaperone 2018	CLOSED	01/11/18	02/09/18	horowsah	10
test	CLOSED	01/12/18	01/24/18	Uttkarsh	1
Biophysical chemistry workshop University of Edinburgh	CLOSED	01/12/18	02/11/18	jmichel80	14
Noc Biologow 2018 WB UW	CLOSED	01/12/18	01/13/18	decu	13
test contest 04	CLOSED	01/13/18	01/31/18	josh04	1
test for josh03	CLOSED	01/15/18	01/22/18	josh03	1
testbibs	CLOSED	01/16/18	01/17/18	Addreoran	1
DU Enzyme 2018	CLOSED	01/17/18	02/16/18	horowsah	10
PM_1	CLOSED	01/17/18	01/27/18	PM_KSienkiewicz	0
PM_2	CLOSED	01/18/18	01/27/18	PM_KSienkiewicz	5
Ali G	CLOSED	01/22/18	01/29/18	JonnyT	0
Human Neuritin	CLOSED	01/25/18	02/24/18	Topo24	1
pranav	CLOSED	01/28/18	01/29/18	pranavchels	0
test contest	CLOSED	02/05/18	02/08/18	samicheen	1
Test custom contest	CLOSED	02/06/18	02/11/18	samicheen	1
CH 410 EC	CLOSED	02/09/18	03/09/18	ProfCollins	10
DU AB 2018	CLOSED	02/12/18	03/12/18	horowsah	10
For Fun	CLOSED	02/12/18	03/12/18	srinaldi1656	1
acka	CLOSED	02/15/18	03/17/18	rolfpf	1
Lol tuturial	CLOSED	02/20/18	02/21/18	danielvan1994	3
phosphate	CLOSED	03/01/18	03/29/18	horowsah	2
HIV	CLOSED	03/01/18	03/29/18	horowsah	1
groel	CLOSED	03/01/18	03/29/18	horowsah	1
enzyme	CLOSED	03/01/18	03/29/18	horowsah	1
ADAM	CLOSED	02/28/18	03/27/18	psloliveira	1
citodomain	CLOSED	02/28/18	03/27/18	psloliveira	1
GeneDesign	CLOSED	03/08/18	04/07/18	chingsong	55
pranavtest	CLOSED	03/15/18	03/16/18	pranavchels	0
PM_PEGAZ	CLOSED	03/20/18	03/31/18	PM_KSienkiewicz	11
2002949_0000 test	CLOSED	03/22/18	03/31/18	Seth Cooper	0
2002949_0000_from_scooper	CLOSED	03/26/18	03/31/18	bkoep	1
2003169_S953	CLOSED	03/25/18	03/31/18	bkoep	1
2002949_0000	CLOSED	03/25/18	04/22/18	bkoep	3
WSC Bioc1 S18 EC	CLOSED	04/02/18	04/22/18	jcnichols	13
test17	CLOSED	04/03/18	04/04/18	horowsah	0
test18	CLOSED	04/03/18	04/04/18	horowsah	0
test17	CLOSED	04/05/18	04/06/18	horowsah	1
test18	CLOSED	04/05/18	04/06/18	horowsah	1
test19	CLOSED	04/05/18	04/06/18	horowsah	1
cavs 49-30	CLOSED	04/06/18	04/13/18	2013345	1
test	CLOSED	04/07/18	04/08/18	samicheen	0
CCBs-Next-TopModel	CLOSED	04/09/18	04/30/18	AnnaSophalK	1
Turma 302 COLTEC	CLOSED	04/09/18	04/20/18	camiladlopes	1
Desafio proteínas do HIV	CLOSED	04/09/18	04/20/18	camiladlopes	1
biotek	CLOSED	04/10/18	04/13/18	Aminstrater	1
4bws test	CLOSED	04/11/18	04/13/18	bkoep	1
test20	CLOSED	04/11/18	04/12/18	horowsah	0
abc	CLOSED	04/14/18	04/15/18	samicheen	0
test30	CLOSED	04/16/18	04/17/18	horowsah	1
test description	CLOSED	04/16/18	04/17/18	samicheen	0
test31	CLOSED	04/18/18	04/19/18	horowsah	0
test title	CLOSED	04/20/18	04/27/18	Seth Cooper	0
test32	CLOSED	04/23/18	04/24/18	horowsah	1
test32	CLOSED	04/26/18	04/27/18	horowsah	1
test33	CLOSED	05/01/18	05/02/18	horowsah	1
Challanger40s	CLOSED	05/02/18	05/27/18	MatheRaph	1
customposter contest	CLOSED	05/03/18	05/31/18	customposter	1
test34	CLOSED	05/03/18	05/05/18	horowsah	1
test35	CLOSED	05/03/18	05/04/18	horowsah	0
contest_node_form contest_node_form	CLOSED	05/10/18	05/13/18	customposter	0
2003333_0006 zip	CLOSED	05/03/18	05/17/18	bkoep	1
template contest test 2	CLOSED	05/07/18	05/14/18	Seth Cooper	0
custom contest test 2	CLOSED	05/07/18	05/14/18	Seth Cooper	0
template contest test 3	CLOSED	05/07/18	05/14/18	Seth Cooper	0
custom contest test 3	CLOSED	05/07/18	05/14/18	Seth Cooper	0
test template	CLOSED	05/04/18	05/05/18	samicheen	0
2003333_0006 zip2	CLOSED	05/06/18	05/27/18	bkoep	1
2003333_0006	CLOSED	05/06/18	05/27/18	bkoep	2
test_edit2	CLOSED	05/06/18	05/13/18	bkoep	1
test35	CLOSED	05/06/18	05/07/18	horowsah	1
test36444	CLOSED	05/06/18	05/07/18	horowsah	1
Custom Contest 1	CLOSED	05/08/18	05/10/18	customposter	0
Custom Contest	CLOSED	05/08/18	05/10/18	customposter	2
Freestyle Design: Variable Length	CLOSED	05/10/18	05/11/18	ac281201	1
500 proteine	CLOSED	05/14/18	05/18/18	01010011111	1
Heather and Nate	CLOSED	05/16/18	05/17/18	heatherlapier	1
test	CLOSED	05/16/18	05/17/18	customposter	1
test1	CLOSED	05/16/18	05/17/18	customposter	1
test2	CLOSED	05/16/18	05/17/18	customposter	1
Heather and Nate Round 2	CLOSED	05/16/18	05/17/18	heatherlapier	2
Heather and Nate Round 3 LOL	CLOSED	05/16/18	05/17/18	heatherlapier	2
another test	CLOSED	05/17/18	05/19/18	josh03	0
TEST UofGuelph iGEM 2018 oxIT	CLOSED	05/21/18	06/20/18	RestrictionEndoNykolease	3
Test FDVL	CLOSED	05/21/18	06/20/18	Madde	1
Loci's test contest test	CLOSED	05/21/18	05/22/18	LociOiling	1
trial	CLOSED	05/22/18	05/31/18	customposter	2
test2	CLOSED	05/22/18	05/31/18	customposter	1
test3	CLOSED	05/22/18	05/31/18	customposter	1
test pdb	CLOSED	05/24/18	05/25/18	samicheen	1
5GOZ Test Contest	CLOSED	05/24/18	06/21/18	Matthew Hantsbarger	4
2003333_0006_test	CLOSED	05/24/18	05/31/18	bkoep	1
test puzzle	CLOSED	05/24/18	05/25/18	samicheen	1
test puzzle new	CLOSED	05/24/18	05/25/18	samicheen	1
test puzzle uncheck	CLOSED	05/24/18	05/25/18	samicheen	0
5GOZ test contest 6	CLOSED	05/29/18	06/26/18	Matthew Hantsbarger	5
test	CLOSED	05/29/18	05/30/18	joshmiller	0
test pdb	CLOSED	05/30/18	05/31/18	samicheen	1
testt	CLOSED	06/06/18	06/07/18	horowsah	1
5GOZ test contest 6.3	CLOSED	06/06/18	07/04/18	Matthew Hantsbarger	1
Lindert OSC Day	CLOSED	06/20/18	06/22/18	bowman1334	2
5GOZ test contest 6.8	CLOSED	06/19/18	07/17/18	Matthew Hantsbarger	1
test	CLOSED	06/22/18	07/16/18	Bruno Kestemont	0
Abeta Binder Test2	CLOSED	06/25/18	07/02/18	Matthew Hantsbarger	1
What can you do???	CLOSED	06/25/18	06/26/18	Carrie_W	1
The coolest in 5212	CLOSED	06/29/18	07/09/18	CarlQAQ	1
Loci's variable length design contest	CLOSED	07/03/18	07/31/18	LociOiling	3
test	CLOSED	07/07/18	07/31/18	tyler0911	1
nanobody	CLOSED	07/09/18	08/07/18	Bogdan Barnych	1
GeneDesign2nd	CLOSED	07/12/18	07/29/18	chingsong	1
test	CLOSED	07/13/18	07/14/18	qk9031	1
5GOZ 9.0 test	CLOSED	07/19/18	07/26/18	Matthew Hantsbarger	2
helphaver	CLOSED	07/21/18	07/24/18	korinnac	0
FREESTYLE	CLOSED	07/21/18	07/22/18	aneeta	0
Moe	CLOSED	07/22/18	08/20/18	ivalnic	1
Abeta Binder Piecewise Design	CLOSED	08/16/18	08/31/18	Uttkarsh	1
SEAL MYOGLOBIN	CLOSED	08/16/18	08/31/18	Uttkarsh	1
Freestyle Design: Variable Length	CLOSED	08/16/18	08/31/18	Uttkarsh	1
test 1	CLOSED	08/19/18	09/16/18	qk9031	1
test -2	CLOSED	08/19/18	08/31/18	qk9031	1
test_fetch_contest	CLOSED	08/29/18	08/31/18	bkoep	1
test_fetch_cleared_cache	CLOSED	08/30/18	09/06/18	bkoep	1
test_contest_resiefilter	CLOSED	08/30/18	09/06/18	bkoep	1
test_contest_rmsdfilter	CLOSED	08/30/18	09/06/18	bkoep	1
test	CLOSED	09/01/18	09/02/18	peterwashington	1
Martin's foldfest	CLOSED	09/05/18	09/06/18	sanmartin	2
this is a test	CLOSED	09/13/18	09/16/18	merlin2v	1
Denovo design 1	CLOSED	09/18/18	10/01/18	zhart	1
designprotein	CLOSED	09/20/18	10/20/18	pwseo	1
BC 124 - UPM - FoldIt Challenge	CLOSED	09/24/18	10/08/18	Quantumerical	16
polyVC1	CLOSED	09/25/18	09/25/19	bkoep	4
polyVC2	CLOSED	09/26/18	09/26/19	bkoep	2
polyVF1	CLOSED	09/26/18	09/26/19	bkoep	2
polyVF2	CLOSED	09/26/18	09/26/19	bkoep	2
polyVZ1	CLOSED	09/26/18	09/26/19	bkoep	2
polyVZ2	CLOSED	09/26/18	09/26/19	bkoep	2
test40	CLOSED	09/26/18	09/27/18	horowsah	2
test-custom16	CLOSED	10/01/18	10/07/18	Seth Cooper	0
test-custom17	CLOSED	10/01/18	10/07/18	Seth Cooper	0
test-custom19	CLOSED	10/01/18	10/07/18	Seth Cooper	1
test-custom20	CLOSED	10/01/18	10/07/18	Seth Cooper	1
test-custom21	CLOSED	10/01/18	10/07/18	Seth Cooper	1
test-custom21	CLOSED	10/01/18	10/07/18	Seth Cooper	1
test46	CLOSED	10/03/18	10/06/18	horowsah	1
a-Synuclein Inhibitor Test	CLOSED	10/03/18	10/31/18	SleepyPanda123	1
Inhibitor design vs a-syn	CLOSED	10/03/18	10/31/18	SleepyPanda123	1
Beginner Puzzle	CLOSED	10/05/18	10/07/18	yayiding	1
Beginner Puzzle Pro	CLOSED	10/05/18	10/20/18	yayiding	1
test46	CLOSED	10/08/18	10/09/18	horowsah	2
test47	CLOSED	10/08/18	10/09/18	horowsah	1
test48	CLOSED	10/08/18	10/09/18	horowsah	1
test49	CLOSED	10/08/18	10/09/18	horowsah	1
test50	CLOSED	10/08/18	10/09/18	horowsah	1
test51	CLOSED	10/08/18	10/09/18	customposter	1
FA18_CH410_EC	CLOSED	01/01/30	11/08/18	ProfCollins	14
test-custom1	CLOSED	10/15/18	10/21/18	Seth Cooper	0
test-custom2	CLOSED	10/15/18	10/22/18	Seth Cooper	1
test50	CLOSED	10/14/18	10/15/18	horowsah	1
Spider Silk	CLOSED	10/19/18	10/31/18	icaru-5	1
Loci's test contest test	CLOSED	10/28/18	10/30/18	LociOiling	0
Practice for HIV Protease	CLOSED	10/28/18	11/20/18	DaedalusLabs	1
WSU Fall 2018 EC Contest	CLOSED	10/31/18	11/12/18	jcnichols	13
Ellington Biochemistry Class	CLOSED	11/08/18	11/13/18	emkbowman	6
WSU Fall 18 EC temp	CLOSED	11/07/18	11/18/18	jcnichols	1
Loci's seal myoglobin test	CLOSED	11/12/18	11/19/18	LociOiling	2
Loci's T0743 contest	CLOSED	11/12/18	11/19/18	LociOiling	1
Are you kidding me?	CLOSED	11/13/18	11/14/18	jcnichols	1
IBG2	CLOSED	11/23/18	11/24/18	ujehn	1
Gaming For Research Event	CLOSED	11/27/18	11/28/18	walid.alitani	28
AlbA,	CLOSED	12/03/18	01/02/19	icaru-5	1
CASP13	CLOSED	12/05/18	12/31/18	callmekoo	1
freestyle	CLOSED	12/06/18	12/31/18	xm109sr	1
biol1300_2018	CLOSED	01/01/30	12/31/18	biol1300_nick	19
biol1300_2018_2	CLOSED	12/06/18	12/31/18	biol1300_nick	19
biol1300_2018_3	CLOSED	12/06/18	12/31/18	biol1300_nick	16
zz zz	CLOSED	12/11/18	12/19/18	CaoKBiol1300	1
SMT 1	CLOSED	12/13/18	12/21/18	levand.csa	1
testb	CLOSED	12/17/18	12/18/18	horowsah	1
guanzhuang	CLOSED	12/19/18	01/18/19	chingsong	32
2002290_S122	CLOSED	01/09/19	01/16/19	bkoep	2
Noc Biologów 2019	CLOSED	01/11/19	01/12/19	decu	15
test	CLOSED	01/11/19	01/12/19	mdziurzynski	0
Otter Gang	CLOSED	01/15/19	01/16/19	CB19Tuck	0
DU TAR puzzle	CLOSED	01/23/19	02/01/19	horowsah	9
CHE 8592 Greek Key Challenge 2019	CLOSED	01/28/19	02/12/19	jakelmer	9
MGC 2019 - HIV protease	CLOSED	01/31/19	02/06/19	Ms Jackson	1
MGC 2019 - GTPase RAS	CLOSED	01/31/19	02/06/19	Ms Jackson	1
P16C8U	CLOSED	02/01/19	02/08/19	obedes	1
DU chaperone folding puzzle	CLOSED	02/07/19	02/15/19	horowsah	9
CHE 8592 Greek Key Challenge 2019 v2.0	CLOSED	02/11/19	02/26/19	jakelmer	17
Enzymology puzzle	CLOSED	02/17/19	02/22/19	horowsah	4
Enzymology puzzle 2	CLOSED	02/18/19	02/22/19	horowsah	8
freestyle design 40	CLOSED	02/27/19	03/04/19	jguerra5	1
CHE 8592 Greek Key Challenge 2019 v3.0	CLOSED	02/27/19	03/12/19	jakelmer	1
CH_410_EC	CLOSED	01/01/30	04/04/19	ProfCollins	12
Symmetric Trimer Design - 80 segs	CLOSED	03/06/19	04/05/19	jamiexq	3
Loci's new test contest	CLOSED	03/08/19	04/07/19	LociOiling	1
DU A-Beta puzzle	CLOSED	03/09/19	03/18/19	horowsah	9
USTB2019	CLOSED	03/11/19	04/10/19	chingsong	51
Waiwera	CLOSED	03/13/19	04/12/19	Aminal88	1
Greek Key 3.0	CLOSED	03/28/19	04/27/19	jakelmer	1
WSC Bioc S19	CLOSED	04/08/19	04/22/19	jcnichols	11
hiv	CLOSED	04/08/19	04/30/19	dbuske	1
EPD 8 Bioinformatica	CLOSED	04/10/19	04/30/19	agonriv	2
Upo Crazy	CLOSED	04/11/19	04/30/19	chochito	0
test	CLOSED	04/30/19	05/01/19	charlottemason	0
Test	CLOSED	01/01/30	04/30/19	charlottemason	0
SSTU	CLOSED	04/23/19	04/30/19	tretbutanol	1
Gingivitis	CLOSED	04/30/19	05/30/19	Aminal88	1
Itfs-2019	CLOSED	04/30/19	05/09/19	ITFS2019	1
Adisdzik dzik	CLOSED	05/14/19	05/24/19	stanio	1
An Experiment	CLOSED	05/15/19	05/20/19	Phil8	1
ha_test	CLOSED	05/22/19	05/31/19	bkoep	2
test_scoreboard	CLOSED	05/22/19	05/31/19	bkoep	2
Festa Scienze 2019	CLOSED	06/07/19	06/08/19	abg-2019	1
23333333abcde qqeeeeeeeq eeq	CLOSED	06/09/19	06/11/19	njfuzjs	1
233233233	CLOSED	06/09/19	06/11/19	ABF	0
TPT_test_puzzle	CLOSED	06/13/19	06/20/19	bkoep	10
Hemagglutinin Binder Design	CLOSED	06/13/19	06/20/19	bkoep	10
Come join my constest -Cloudy101	CLOSED	06/15/19	06/29/19	Cloudy101	1
GRC demo	CLOSED	06/17/19	06/22/19	horowsah	1
DUKE TIP	CLOSED	06/19/19	06/29/19	buttmanjoe	2
test	CLOSED	06/24/19	06/30/19	Seth Cooper	0
Private Whitcon	CLOSED	06/21/19	06/24/19	prolylendopeptidase	7
20aa	CLOSED	06/27/19	06/30/19	usagi525	1
Abeta Binder Piecewise	CLOSED	06/28/19	07/27/19	helen88	2
text	CLOSED	06/30/19	07/02/19	pey123456	1
text2	CLOSED	06/30/19	07/02/19	pey123456	1
JOIN	CLOSED	07/01/19	08/01/19	helen88	5
FRIZZLED DESIGN	CLOSED	07/01/19	07/31/19	helen88	3
Contest :)	CLOSED	07/02/19	07/03/19	helen88	1
Hemagglutinin Binder Design	CLOSED	07/02/19	07/09/19	bkoep	2
Wiggle Design	CLOSED	07/02/19	07/09/19	bkoep	2
Backbone Design	CLOSED	07/02/19	07/09/19	bkoep	2
ORMDL3	CLOSED	07/04/19	07/09/19	Michal93	1
ORMDL3	CLOSED	07/03/19	07/17/19	Michal93	1
l1	CLOSED	07/05/19	07/31/19	lnq	1
Hemagglutinin Binder	CLOSED	07/12/19	07/19/19	bkoep	4
COME JOIN	CLOSED	07/13/19	07/31/19	Cloudy101	1
Prova mioglobina	CLOSED	07/17/19	07/18/19	marcodabramo	1
tested	CLOSED	07/19/19	07/20/19	horowsah	1
BrainUnwind-ContestD	CLOSED	07/23/19	07/29/19	PhilippeMarguet	1
Prova	CLOSED	08/03/19	08/04/19	ikemori	2
Prova 2	CLOSED	08/10/19	08/15/19	ikemori	1
PETase Mutants	CLOSED	08/23/19	09/21/19	RestrictionEndoNykolease	1
PETase	CLOSED	08/26/19	09/23/19	RestrictionEndoNykolease	1
PETase 1	CLOSED	08/26/19	09/23/19	RestrictionEndoNykolease	1
test	CLOSED	09/06/19	09/06/19	rigidBiscuit	1
test-40	CLOSED	09/07/19	10/02/19	fosfotrinucleotide	1
advanced bio	CLOSED	09/18/19	09/19/19	hardbass	0
F19_CH410_E1	CLOSED	09/26/19	10/26/19	ProfCollins	12
Kurenan	CLOSED	10/05/19	10/31/19	kurenan	1
Bioc WSU Fall 19	CLOSED	11/06/19	11/24/19	jcnichols	20
How	CLOSED	01/01/30	12/16/19	jan.schmue	1
coupe du monde de cinetique	CLOSED	11/29/19	11/30/19	juanthomas	3
76 aa	CLOSED	11/30/19	12/17/19	JimHughes	1
Abeta BIOL1300	CLOSED	12/09/19	12/31/19	biol1300_nick	18
SEAL MYOGLOBIN BIOL1300	CLOSED	12/09/19	12/31/19	biol1300_nick	18
Frizzled Design Puzzle Contest BIOL1300	CLOSED	12/09/19	12/31/19	biol1300_nick	18
GTPase Ras Biol1300	CLOSED	12/09/19	12/31/19	biol1300_nick	18
Spielwiese	CLOSED	12/17/19	01/16/20	Bithalbierer	1
Spielwiese Trimer	CLOSED	12/18/19	01/16/20	Bithalbierer	1
Freestyle Design:	CLOSED	12/22/19	12/28/19	01010011111	1
For Emily	CLOSED	01/01/20	01/10/20	darron01	2
Loci's Latest	CLOSED	01/05/20	01/06/20	LociOiling	1
Loci's design contest	CLOSED	01/05/20	01/06/20	LociOiling	1
Noc Biologów 2020	CLOSED	01/10/20	01/11/20	decu	15
Test	CLOSED	01/12/20	01/13/20	cassidydobson	1
Chem335 Foldit Assignment	CLOSED	01/01/30	02/19/20	cassidydobson	64
Fold it Cell Bio 2020	CLOSED	01/22/20	01/23/20	CB20HILT	1
Three M contests	CLOSED	01/24/20	01/31/20	karzan11	1
MGC 2020 HIV Protease	CLOSED	01/24/20	02/06/20	Kimbostu	5
Testing	CLOSED	02/02/20	02/28/20	icaru-5	1
OSSM Biochemistry	CLOSED	02/13/20	02/28/20	Brent Richards	1
Test	CLOSED	02/13/20	02/20/20	bkoep	0
testing	CLOSED	02/13/20	02/14/20	horowsah	1
proteine0012	CLOSED	02/15/20	02/18/20	01010011111	1
test contest freestyle variable length	CLOSED	03/04/20	03/06/20	fornaeffe	1
f	CLOSED	03/10/20	03/11/20	Makonede	0
Rossman	CLOSED	03/12/20	03/17/20	mdc_biocat	0
iron core 2	CLOSED	03/16/20	03/31/20	fabio	2
test40	CLOSED	03/20/20	03/21/20	horowsah	1
test41	CLOSED	03/20/20	03/21/20	horowsah	1
test42	CLOSED	03/20/20	03/21/20	horowsah	1
test43	CLOSED	03/20/20	03/21/20	horowsah	1
test44	CLOSED	03/20/20	03/21/20	horowsah	1
Testing	CLOSED	01/01/30	03/22/20	Vater_Ashley	0
test45	CLOSED	03/20/20	03/21/20	horowsah	1
test46	CLOSED	03/20/20	03/21/20	horowsah	1
test47	CLOSED	03/20/20	03/21/20	horowsah	1
test48	CLOSED	03/20/20	03/21/20	horowsah	1
test49	CLOSED	03/20/20	03/21/20	horowsah	1
freestyle	CLOSED	03/22/20	03/22/20	diamonddays	1
test50	CLOSED	03/22/20	03/23/20	horowsah	1
test51	CLOSED	03/22/20	03/23/20	horowsah	1
test52	CLOSED	03/22/20	03/23/20	horowsah	1
test53	CLOSED	03/22/20	03/23/20	horowsah	1
test54	CLOSED	03/22/20	03/23/20	horowsah	1
test55	CLOSED	03/22/20	03/23/20	horowsah	1
thisisatest	CLOSED	03/22/20	03/23/20	tolili	1
test56	CLOSED	03/24/20	03/25/20	horowsah	1
test57	CLOSED	03/24/20	03/25/20	horowsah	1
test58	CLOSED	03/27/20	03/28/20	horowsah	1
we can is can	CLOSED	03/31/20	04/02/20	RealFailure	2
rafes test	CLOSED	04/02/20	04/03/20	rafe_barratt	1